ESTScan Details for Unigene SGN-U303279

Score 
383
Direction 
Forward
Predicted Peptide Sequence 
IKQFTKFLLDNFLQINTTNLDFRAKERVENAAIKEKAANVAASAKSGMEKTKATMQEKVDRATANNPTEKEMATERKEQRVNQAEFDKRA
AQEHNAAARNATKNTGQPHTYSTTGAPGHPTGTHQQSALPGHGTGQVTEGVVESHPIGTAAGTGRTNAAHNTHVGAATNIGGSYTQD
Predicted Coding Sequence 
XCAATCAAACAGTTTACAAAGTTTCTCTTAGATAACTTCTTACAAATTAACACTACCAATTTAGATTTCAGAGCAAAAGAGAGAGTGGAA
AATGCAGCCATCAAGGAGAAAGCAGCCAATGTTGCCGCCTCAGCCAAGTCCGGAATGGAGAAAACCAAGGCCACCATGCAAGAGAAGGTT
GATCGTGCCACTGCAAATAATCCAACTGAGAAAGAGATGGCGACAGAGAGGAAGGAACAGAGGGTGAATCAGGCTGAATTTGACAAGCGT
GCGGCTCAGGAGCATAACGCTGCGGCTAGGAATGCAACCAAAAACACTGGCCAGCCGCACACCTATTCCACCACGGGTGCACCAGGACAT
CCTACCGGGACTCATCAGCAGTCGGCCTTGCCCGGCCATGGCACCGGACAAGTTACCGAAGGCGTGGTTGAGTCCCACCCCATTGGGACG
GCCGCTGGGACTGGCAGGACTAATGCAGCCCATAACACCCATGTTGGTGCGGCTACTAACATTGGTGGTTCTTATACTCAAGACTAG
Edits in Original Sequence 
(5')XCAATCAAACAGTTTACAAAGTTTCTCTTAGATAACTTCTTACAAATTAACACTACCAATTTAGATTTCAGAGCAAAAGAGAGAGT
GGAAAATGCAgGCCATCAAGGAGAAAGCAGCCAATGTTGCCGCCTCAGCCAAGTCCGGAATGGAGAAAACCAAGGCCACCATGCAAGAGA
AGGTTGATCGTGCCACTGCAAATAATCCAACTGAGAAAGAGATGGCGACAGAGAGGAAGGAACAGAGGGTGAATCAGGCTGAATTTGACA
AGCGTGCGGCTCAGGAGCATAACGCTGCGGCTAGGAATGCAACCAAAAACACTGGCCAGCCGCACACCTATTCCACCACGGGTGCACCAG
GACATCCTACCGGGACTCATCAGCAGTCGGCCTTGCCCGGCCATGGCACCGGACAAGTTACCGAAGGCGTGGTTGAGTCCCACCCCATTG
GGACGGCCGCTGGGACTGGCAGGACTAATGCAGCCCATAACACCCATGTTGGTGCGGCTACTAACATTGGTGGTTCTTATACTCAAGACT
AG(3')ATTAGATCATTGGACCTTTTAAACCTTGCTTTGAATAAGGACTTGGAACCCTTTTTAAGTTGGACGGTCCACTTGTTGTATTCG
ACTATNTCTGATCTAGGTTACTTAGCTTGCTTTTTCGAAATGTCATTTGTAGGTTCACTTCTAGCATCTATATATGTAAAAGTGGTCATC
ACTATGAGTGACTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan