ESTScan Details for Unigene SGN-U303477

Score 
1334
Direction 
Forward
Predicted Peptide Sequence 
LAAKYDVDFCQGKSACQARAISRYSTAAALEEPIKPPVNVEYTKLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDVNRAVAAAR
KAFDEGPWPKLTAYDRQRILLRFADLVEKHNDEIAALETWDNGKPYEQAAKIEVPMFVRLMRYYAGWADKIHGMTVPADGPYHVQTLHEP
IGVAGQIIPWNFPLLMYAWKVGPALACGNTVVLKTAEQTPLSALYVTKLLHEAGLPSGVLNVVSGFGPTAGAALCSHMDVDKLAFTGSTE
TGKIILELSARSNLKPVTLELGGKSPFIVCEDADVDNAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKATARALKRSVGDPFRQE
IEQGPQVDSEQFEKILRYIRAGVDS
Predicted Coding Sequence 
AXATTAGCTGCCAAATATGATGTCGATTTTTGTCAAGGAAAAAGTGCTTGCCAAGCAAGAGCAATTTCTCGGTATAGCACTGCTGCTGCT
CTCGAGGAGCCAATTAAGCCACCGGTTAATGTGGAATACACTAAGCTTCTCATTAATGGTCAATTTGTTGATGCAGCCTCAGGGAAGACA
TTTCCAACTCTGGACCCTAGAACAGGGGAAGTGATTGCGCATGTTGCTGAAGGTGATGCAGAAGATGTCAACAGAGCTGTGGCTGCTGCT
CGCAAGGCTTTTGATGAAGGACCCTGGCCCAAGCTGACTGCTTATGATCGGCAAAGAATATTGCTACGCTTCGCTGATTTAGTCGAGAAG
CATAACGACGAAATTGCAGCACTAGAGACTTGGGATAATGGCAAGCCATATGAACAAGCAGCTAAAATTGAAGTTCCTATGTTTGTGCGC
CTCATGCGATATTATGCTGGTTGGGCCGACAAGATTCATGGGATGACCGTTCCTGCTGATGGACCTTATCATGTTCAAACTCTGCATGAA
CCCATTGGTGTTGCTGGACAAATTATTCCGTGGAACTTCCCTCTCCTAATGTATGCTTGGAAGGTTGGGCCTGCATTAGCATGTGGCAAC
ACCGTTGTGCTCAAGACAGCAGAGCAGACACCATTATCTGCTCTATATGTGACAAAGCTGTTGCATGAGGCTGGGCTTCCATCAGGTGTT
CTGAATGTGGTGTCTGGCTTTGGTCCAACAGCTGGCGCTGCTCTTTGCAGCCATATGGATGTGGACAAGCTTGCCTTCACTGGATCAACA
GAAACTGGAAAGATTATTCTTGAATTGTCTGCTAGAAGCAACCTTAAGCCAGTGACTTTGGAACTTGGAGGCAAATCTCCTTTTATTGTT
TGTGAGGATGCTGATGTGGACAATGCTGTCGAGCTAGCCCACTTTGCACTTTTCTTTAACCAGGGACAATGTTGCTGTGCTGGCTCCCGC
ACATATGTTCATGAACGTGTTTATGATGAATTTGTGGAGAAAGCCACTGCACGTGCATTGAAACGCAGTGTTGGAGATCCATTCAGGCAA
GAAATAGAACAAGGTCCTCAGGTTGACTCAGAACAGTTTGAGAAAATTTTGAGATATATTAGAGCTGGAGTCGATAGT
Edits in Original Sequence 
(5')AXATTAGCTGCCAAATATGATGTCGATTTTTGTCAAGGAAAAAGTGCTTGCCAAGCAAGAGCAATTTCTCGGTATAGCACTGCTGC
TGCTCTCGAGGAGCCAATTAAGCCACCGGTTAATGTGGAATACACTAAGCTTCTCATTAATGGTCAATTTGTTGATGCAGCCTCAGGGAA
GACATTTCCAACTCTGGACCCTAGAACAGGGGAAGTGATTGCGCATGTTGCTGAAGGTGATGCAGAAGATGTCAACAGAGCTGTGGCTGC
TGCTCGCAAGGCTTTTGATGAAGGACCCTGGCCCAAGCTGACTGCTTATGATCGGCAAAGAATATTGCTACGCTTCGCTGATTTAGTCGA
GAAGCATAACGACGAAATTGCAGCACTAGAGACTTGGGATAATGGCAAGCCATATGAACAAGCAGCTAAAATTGAAGTTCCTATGTTTGT
GCGCCTCATGCGATATTATGCTGGTTGGGCCGACAAGATTCATGGGATGACCGTTCCTGCTGATGGACCTTATCATGTTCAAACTCTGCA
TGAACCCATTGGTGTTGCTGGACAAATTATTCCGTGGAACTTCCCTCTCCTAATGTATGCTTGGAAGGTTGGGCCTGCATTAGCATGTGG
CAACACCGTTGTGCTCAAGACAGCAGAGCAGACACCATTATCTGCTCTATATGTGACAAAGCTGTTGCATGAGGCTGGGCTTCCATCAGG
TGTTCTGAATGTGGTGTCTGGCTTTGGTCCAACAGCTGGCGCTGCTCTTTGCAGCCATATGGATGTGGACAAGCTTGCCTTCACTGGATC
AACAGAAACTGGAAAGATTATTCTTGAATTGTCTGCTAGAAGCAACCTTAAGCCAGTGACTTTGGAACTTGGAGGCAAATCTCCTTTTAT
TGTTTGTGAGGATGCTGATGTGGACAATGCTGTCGAGCTAGCCCACTTTGCACTTTTCTTTAACCAGGGACAATGTTGCTGTGCTGGCTC
CCGCACATATGTTCATGAACGTGTTTATGATGAATTTGTGGAGAAAGCCACTGCACGTGCATTGAAACGCAGTGTTGGAGATCCATTCAG
GCAAGAAATAGAACAAGGTCCTCAGGTTGACTCAGAACAGTTTGAGAAAATTTTGAGATATATTAGAGCTGGAGTCGATAGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan