ESTScan Details for Unigene SGN-U303484

Score 
568
Direction 
Forward
Predicted Peptide Sequence 
MPSNIQIPSTKAIISAAASVTATAMLIRSFANDIIPQEFRHFFFTKVHQLFTAFSNEVILAIDEFDGLGQNQLFKAVEVYLGSIQVRPPK
GFGATLPQKEKKINVYMESSEELTQQFNGIQLKWRMVREQIQPRYVTMPGDYNSTMISEHRFYELIFHKKHKEMVIGEYLPYVLERSKAV
EVEKKTLKLFMLGNDRMMGX
Predicted Coding Sequence 
ATGCCTTCAAACATCCAAATACCATCAACCAAAGCAATCATCTCTGCTGCTGCCTCTGTAACTGCCACAGCCATGCTTATTAGGTCCTTC
GCCAATGATATCATCCCCCAGGAGTTCAGACACTTCTTCTTCACCAAAGTTCACCAGCTTTTCACAGCATTCTCCAATGAAGTCATCTTA
GCCATCGATGAATTCGATGGCCTCGGCCAAAATCAACTCTTCAAGGCTGTAGAAGTTTACTTGGGATCCATTCAAGTCCGTCCACCAAAA
GGCTTCGGAGCCACGTTGCCTCAAAAAGAAAAGAAAATCAACGTTTACATGGAAAGCAGTGAAGAACTCACCCAACAATTTAACGGCATC
CAGCTAAAATGGAGGATGGTTCGTGAGCAGATTCAACCGAGATACGTTACGATGCCTGGTGACTACAATTCAACTATGATATCTGAACAC
CGGTTTTATGAATTAATCTTTCACAAGAAGCATAAGGAAATGGTTATTGGTGAGTACTTGCCTTATGTTTTGGAAAGATCCAAGGCTGTT
GAAGTTGAAAAGAAGACACTGAAATTGTTTATGTTGGGAAATGATCGGATGATGGGACAX
Edits in Original Sequence 
TTCTATTTCTGCTTAATTTCCTCGTCATTCCAGCTTCACAGATTGGAAACAAAAAAATTCCAAAAAGAATTCCACTGAATCTCAGCCTCA
TTCCTCTTGATTCTTTGTTTATATTTTGAAGTACCTGGAACCCTCTTCAGCTACATCAAACCCCATTGATCTGACTTCCTGAAAACAATT
CCCCGAAGGGCATAAACTTTTCAACAGTCAGCC
(5')ATGCCTTCAAACATCCAAATACCATCAACCAAAGCAATCATCTCTGCTGCTGC
CTCTGTAACTGCCACAGCCATGCTTATTAGGTCCTTCGCCAATGATATCATCCCCCAGGAGTTCAGACACTTCTTCTTCACCAAAGTTCA
CCAGCTTTTCACAGCATTCTCCAATGAAGTCATCTTAGCCATCGATGAATTCGATGGCCTCGGCCAAAATCAACTCTTCAAGGCTGTAGA
AGTTTACTTGGGATCCATTCtAAGTCCGTCCACCAAAAGGCTTCGGAGCCACGTTGCCTCAAAAAGAAAAGAAAATCAACGTTTACATGG
AAAGCAGTGAAGAACTCACCCAACAATTTAACGGCATCCAGCTAAAATGGAGGATGGTTCGTGAGCAGATTCAACCGAGATACGTTACGA
TGCCTGGTGACTACAATTCAACTATGATATCTGAACACCGGTTTTATGAATTAATCTTTCACAAGAAGCATAAGGAAATGGTTATTGGTG
AGTACTTGCCTTATGTTTTGGAAAGATCCAAGGCTGTTGAAGTTGAAAAGAAGACACTGAAATTGTTTATGTTGGGAAATGATCGGATGA
TGGGACAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan