ESTScan Details for Unigene SGN-U303582

Score 
406
Direction 
Forward
Predicted Peptide Sequence 
MXFPLAPKQAMPVKPTSFRDRTLEFQSVADRLRKSSSSASNAPSSSGAGAYDAGGGGLRIHGSTFSIRCPDSIRIQPESVQNRARDPPPS
QKLSKLAKLAKRSSVFDDPTVEIQELTAVIKQDITALNSAVVDLQLLSNSQSESGLSTDSAAHSTTVVDNLKNSLMGATQEFKNVLTKRT
ENLKVHENRRQLFSNTTKESTNPFVRQRPLASRTSSNSAISPPPWANGSX
Predicted Coding Sequence 
ATGTAATTTCCGCTTGCTCCAAAGCAAGCAATGCCTGTCAAACCCACTTCTTTCAGAGATCGGACGCTAGAGTTTCAGAGCGTCGCCGAC
AGGCTCAGGAAATCATCGTCCTCGGCTTCTAATGCCCCCAGCAGTAGCGGAGCCGGAGCCTACGACGCCGGCGGCGGXGGGCTTCGCATC
CACGGCTCAACCTTCTCGATCCGCTGCCCCGATTCAATCCGAATTCAACCGGAGAGCGTCCAGAATCGCGCTAGGGATCCACCACCCTCT
CAGAAACTGTCCAAGCTTGCTAAATTGGCTAAGAGATCATCAGTTTTTGATGATCCAACTGTGGAAATTCAAGAGTTGACAGCTGTAATC
AAGCAGGATATTACAGCACTTAACTCTGCCGTGGTAGACCTCCAGCTCTTAAGCAATTCCCAGAGTGAAAGTGGTTTGTCAACTGATAGC
GCTGCACATTCAACTACAGTTGTCGATAACTTGAAGAATAGCTTGATGGGTGCCACACAAGAGTTCAAAAATGTACTAACCAAACGGACA
GAGAACCTCAAGGTTCATGAAAACCGAAGGCAGTTGTTTTCAAATACAACAAAAGAATCCACCAATCCTTTTGTTCGCCAGCGCCCCTTG
GCGAGCAGAACATCATCCAATTCTGCAATATCTCCCCCTCCATGGGCAAATGGCTCCAXX
Edits in Original Sequence 
TTCACGGCACCTCCGTTCCAGATCTACTCCTTTTAAATTTCCAAAGTTTATTCTTACACATCCATTTGCAATTTAGCGCGTTTAGAATTA
GAGAAGAGACGAGATAAATTTTCTTT
(5')ATGTAATTTCCGCTTGCTCCAAAGCAAGCAATGCCTGTCAAACCCACTTCTTTCAGAGAT
CGGACGCTAGAGTTTCAGAGCGTCGCCGACAGGCTCAGGAAATCATCGTCCTCGGCTTCTAATGCCCCCAGCAGTAGCGGAGCCGGAGCC
TACGACGCCGGCGGCGGXGGGCTTCGCATCCACGGCTCAACCTTCTCGATCCGCTGCCCCGATTCAATCCGAATTCAACCGGAGAGCGTC
CAGAATCGCGCTAGGGATCCACCACaCCTCTCAGAAACTGTCCAAGCTTGCTAAATTGGCTAAGAGATCATCAGTTTTTGATGATCCAAC
TGTGGAAATTCAAGAGTTGACAGCTGTAATCAAGCAGGATATTACAGCACTTAACTCTGCCGTGGTAGACCTCCAGCTCTTAAGCAATTC
CCAGAGTGAAAGTGGTTTGTCAACTGATAGCGCTGCACATTCAACTACAGTTGTCGATAACTTGAAGAATAGCTTGATGGGTGCCACACA
AGAGTTCAAAAATGTACTAACCAAACGGACAGAGAACCTCAAGGTTCATGAAAACCGAAGGCAGTTGTTTTCAAATACAACAAAAGAATC
CACCAATCCTTTTGTTCGCCAGCGCCCCTTGGCGAGCAGAACATCATCCAATTCTGCAATATCTCCCCCTCCATGGGCAAATGGCTCCAX
X(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan