Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U303686

Score 
361
Direction 
Forward
Predicted Peptide Sequence 
RMLVDAEQYLLSQKLSDLTKDDLYEVKKRGFSDKQIAFATKTTEKEVRLKRLSLGVKPAYKRVDTCAAEFEANTPYMYSSYDFECESAPT
QRKKVLILGGGPNRIGQGIEFDYCCCHTSFALQDAGYETIMMNSNPETVSTDYDTSDRLYFEPLTVEDVLNIIDLEGPDGIIVQFGGQTP
LKLALX
Predicted Coding Sequence 
AGGATGCTTGTAGATGCGGAACAATATCTTTTGTCTCAGAAGTTGTCTGATTTAACAAAGGATGACCTCTATGAAGTGAAAAAGAGAGGT
TTCAGTGATAAACAGATAGCTTTTGCTACAAAAACGACAGAGAAAGAAGTTCGGTTAAAGCGGTTATCATTGGGTGTTAAACCAGCATAT
AAGCGAGTTGATACATGTGCTGCCGAATTTGAGGCTAATACTCCTTACATGTACTCATCTTATGACTTTGAGTGTGAATCAGCTCCCACC
CAAAGAAAAAAGGTTCTGATTTTAGGTGGTGGACCAAATCGGATTGGTCAAGGGATTGAATTTGATTACTGCTGCTGCCACACATCATTT
GCCCTCCAGGATGCAGGCTATGAGACAATCATGATGAATTCGAATCCTGAAACAGTATCTACAGATTATGATACAAGTGATCGTCTCTAT
TTTGAACCGCTGACAGTTGAAGATGTTCTCAACATAATAGATTTGGAGGGGCCTGATGGGATAATTGTGCAGTTTGGAGGTCAAACACCA
TTGAAGCTGGCTCTTCXX
Edits in Original Sequence 
(5')AGGATGCTTGTAGATGCGGAACAATATCTTTTGTCTCAGAAGTTGTCTGATTTAACAAAGGATGACCTCTATGAAGTGAAAAAGAG
AGGTTTCAGTGATAAACAGATAGCTTTTGCTACAAAAACGACAGAGAAAGAAGTTCGGTTAAAGCGGTTATCATTGGGTGTTAAACCAGC
ATATAAGCGAGTTGATACATGTGCTGCCGAATTTGAGGCTAATACTCCTTACATGTACTCATCTTATGACTTTGAGTGTGAATCAGCTCC
CACCCAAAGAAAAAAGGTTCTGATTTTAGGTGGTGGACCAAATCGGATTGGTCAAGGGATTGAATTTGATTACTGCTGCTGCCACACATC
ATTTGCCCTCCAGGATGCAGGCTATGAGACAATCATGATGAATTCGAATCCTGAAACAGTATCTACAGATTATGATACAAGTGATCGTCT
CTATTTTGAACCGCTGACAGTTGAAGATGTTCTCAACATAATAGATTTGGAGGGGCCTGATGGGATAATTGTGCAGTTTGGAGGTCAAAC
ACCATTGAAGCTGGCTCTTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan