ESTScan Details for Unigene SGN-U303720

Score 
312
Direction 
Forward
Predicted Peptide Sequence 
ADQPSIPSAAQRVARTNSDVPRSGSFVHPFIVGHSSAARAGSSVVSSMIPPYPGSVARARDRVQALQAYFQQPSNTPSIRNPVMSGSRRS
SAHRSVAQVGPVASSSDQTGAFYFIPSSSSGKPIKKQKIPCPIASMVGTENTCLPFPRXQIDRDSGWGPFHQAAGGADGSLRTNSFRQRH
GPXEDAITKSVIDCLLCRDETL
Predicted Coding Sequence 
GCTGATCAACCCTCAATCCCATCCGCGGCTCAAAGAGTAGCTAGAACGAATTCTGATGTTCCGAGATCGGGATCCTTTGTGCATCCTTTC
ATTGTTGGTCACAGTTCTGCTGCCAGAGCTGGGAGCTCAGTTGTCTCATCAATGATTCCACCTTACCCTGGCAGTGTAGCTCGGGCCCGA
GACCGTGTTCAAGCTCTTCAGGCATATTTTCAGCAACCAAGCAATACACCATCAATACGCAATCCAGTGATGTCTGGATCACGGAGATCA
AGTGCTCATAGGAGTGTGGCACAAGTTGGTCCAGTTGCTTCATCGTCTGACCAGACTGGTGCTTTTTATTTCATCCCTTCAAGTTCATCT
GGAAAACCTATCAAGAAGCAGAAAATTCCCTGCCCAATCGCTTCCATGGTTGGGACCGAGAACACTTGCCTTCCTTTCCCTCGAGXTCAG
ATTGATAGAGACTCGGGTTGGGGACCATTCCATCAAGCAGCTGGTGGGGCTGATGGTAGTCTCAGGACTAACAGCTTTCGTCAGAGGCAT
GGACCTGXAGAGGATGCCATCACAAAATCGGTCATAGACTGCTTATTATGTCGTGATGAAACGTTATGA
Edits in Original Sequence 
(5')GCTGATCAACCCTCAATCCCATCCGCGGCTCAAAGAGTAGCTAGAACGAATTCTGATGTTCCGAGATCGGGATCCTTTGTGCATCC
TTTCATTGTTGGTCACAGTTCTGCTGCCAGAGCTGGGAGCTCAGTTGTCTCATCAATGATTCCACCTTACCCTGGCAGTGTAGCTCGGGC
CCGAGACCGTGTTCAAGCTCTTCAGGCATATTTTCAGCAACCAAGCAATACACCATCAATACGCAATCCAGTGATGTCTGGATCACGGAG
ATCAAGTGCTCATAGGAGTGTGGCACAAGTTGGTCCAGTTGCTTCATCGTCTGACCAGACTGGTGCTTTTTATTTCATCCCTTCAAGTTC
ATCTGGAAgAACCTATCAAGAAGCAGAAAATTCCCTGCCCAATCGCTTCCATGGTTGGGACCGAGAACACTTGCCTTCCTTTCCCTCGAG
XTCAGATTGATAGAGACTCGGGTTGGGGACCATTCCATCAAGCAGCTGGTGGGGCTGATGGTAGTCTCAGGACTAACAGCTTTCGTCAGA
GGCATGGACCTGXAGAGGATGCCATCACAAAATCGGTCATAGACTGCTTATTATGTCGTGATGAAACGTTATGA(3')TAACTATGACTG
AAACACAATTTATATATAATGTTTGAGAAACAATGAACAACAGTTGTAGCCTGTCAAGATTGGCAGACGAAAAGCTGTTAGATGGGCCTT
AAAGTTTGGTGGGCCAGTGATTGTGTGATGGATTTGGGCTTCCTCCTCGTGTCTTGCCTGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan