ESTScan Details for Unigene SGN-U303760

Score 
507
Direction 
Forward
Predicted Peptide Sequence 
QGRARVHEKTACLSLVGSQDXNYRTATGKKSQARYXLWPEQIEINIVVFLLSRFIFSFSKRPGDMGINHYKQSIEXIEKVKELLSXAMVK
ETEYYDILGVSIDASPAEIKKAYYLKARVVHPDKNPNDPKAAHNFQVLGEAYQVLSDPAKRETYDKYGKDGVAQDTMVDPATVFGMQFGS
DFFEDYVGQLRLASLAGVEIDDNSENPDVRTQKIQEKLKALQKDREEKLIGNLKDRLQPFVEGRTNEFVEWAKAEARRLSHAAFGEPMLH
TIGYIYTRQAAREIGKDKR
Predicted Coding Sequence 
CAAGGACGTGCCCGTGTTCATGAGAAAACTGCTTGTCTCTCCCTTGTAGGATCCCAGGACXCCAATTATAGAACTGCTACTGGAAAAAAA
TCACAGGCGAGGTATXATTTGTGGCCAGAGCAGATTGAGATCAATATTGTTGTTTTTCTTCTTTCTCGTTTTATTTTTTCATTCAGCAAA
CGTCCGGGAGATATGGGAATCAATCATTACAAACAATCAATTGAGXTAATTGAGAAGGTAAAAGAGCTTCTTTCTGXAGCTATGGTGAAG
GAAACCGAGTACTATGATATCTTGGGTGTCAGTATAGATGCATCTCCTGCCGAGATTAAGAAAGCATACTACCTAAAGGCAAGGGTAGTG
CACCCAGACAAAAATCCCAACGACCCCAAGGCTGCTCATAATTTCCAGGTACTTGGGGAGGCATATCAGGTATTGAGTGACCCAGCAAAG
CGTGAAACGTACGACAAATATGGAAAAGATGGAGTAGCGCAAGACACCATGGTGGACCCTGCAACTGTGTTTGGCATGCAATTTGGGAGT
GACTTCTTTGAAGATTATGTGGGGCAACTTCGATTGGCTTCTTTGGCAGGGGTTGAAATTGATGATAACTCAGAAAATCCTGATGTGCGC
ACTCAGAAAATTCAGGAAAAGTTAAAGGCATTGCAAAAGGACAGAGAAGAGAAGCTCATAGGAAATTTGAAAGATCGTCTACAACCCTTT
GTTGAAGGTCGAACCAATGAGTTTGTGGAATGGGCAAAAGCAGAAGCTCGTCGTCTTTCTCATGCTGCTTTCGGTGAGCCTATGCTGCAT
ACAATCGGTTATATCTACACCAGGCAGGCTGCAAGAGAAATTGGGAAGGACAAGCGG
Edits in Original Sequence 
(5')CAAGGACGTGCCCGTGTTCATGAGAAAACTGCTTGTCTCTCCCTTGTAGGATCCCAGGACXCCAATTATAGAACTGCTACTGGAAA
AAAATCACAGGCGAGGTATXATTTGTGGCCAGAGCAGATTGAGATCAtATATTGTTGTTTTTCTTCTTTCTCGTTTTATTTTTTCATTCA
GCAAACGTCCGGGAGATAgTGGGAATCAATCATTACAAACAATCAATTGAGXTAATTGAGAAGGTAAtAAGAGCTTCTTTCTGXAGCTAT
GGTGAAGGAAACCGAGTACTATGATATCTTGGGTGTCAGTATAGATGCATCTCCTGCCGAGATTAAGAAAGCATACTACCTAAAGGCAAG
GGTAGTGCACCCAGACAAAAATCCCAACGACCCCAAGGCTGCTCATAATTTCCAGGTACTTGGGGAGGCATATCAGGTATTGAGTGACCC
AGCAAAGCGTGAAACGTACGACAAATATGGAAAAGATGGAGTAGCGCAAGACACCATGGTGGACCCTGCAACTGTGTTTGGCATGCAATT
TGGGAGTGACTTCTTTGAAGATTATGTGGGGCAACTTCGATTGGCTTCTTTGGCAGGGGTTGAAATTGATGATAACTCAGAAAATCCTGA
TGTGCGCACTCAGAAAATTCAGGAAAAGTTAAAGGCATTGCAAAAGGACAGAGAAGAGAAGCTCATAGGAAATTTGAAAGATCGTCTACA
ACCCTTTGTTGAAGGTCGAACCAATGAGTTTGTGGAATGGGCAAAAGCAGAAGCTCGTCGTCTTTCTCATGCTGCTTTCGGTGAGCCTAT
GCTGCATACAATCGGTTATATCTACACCAGGCAGGCTGCAAGAGAAATTGGGAAGGACAAGCGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan