ESTScan Details for Unigene SGN-U303773

Score 
112
Direction 
Forward
Predicted Peptide Sequence 
EKVVTNSQTPILDVLLSFRAQKLKNEPRPWVHVSRLEVQGVQSKDTALEAGSFFRDYVDNVSSIDECLAAGVSPKKIEVCMGGKCKKSGA
AAASGGTSKAVGIEGAVSGCKCMGKCRDGPNVRILKGPSESVTNPLCIGVGLEDVDLIVSNFFGAVLNVASLQHHRXVTVSRMGWLAEPG
LASIXVDATVLVGNGVNISPFSIITRQFRIIIFPHSYRXIRGNILHYLNSRVIAQCFPCLRLAHRADELVKHGGPRIENEEKCLEKYAVI
VNWPRAQYFQPYLSESSYV
Predicted Coding Sequence 
GAAAAGGTCGTGACCAATTCCCAAACACCAATTTTAGATGTTCTGTTGTCATTCAGAGCTCAGAAACTCAAGAACGAACCTCGACCATGG
GTGCATGTGTCGAGATTGGAAGTTCAGGGAGTTCAGAGCAAGGATACTGCTTTGGAAGCXGGTAGCTTCTTTAGAGATTATGTGGATAAT
GTAAGTTCCATTGATGAGTGCCTAGCTGCAGGAGTATCACCCAAGAAAATCGAGGTTTGTATGGGTGGTAAATGCAAGAAATCGGGTGCT
GCAGCXGCTTCTGGGGGAACTTCAAAGGCTGTTGGCATTGAAGGAGCTGTCTCCGGATGCAAGTGCATGGGCAAATGTAGAGATGGTCCT
AATGTGAGGATTCTCAAGGGTCCTTCTGAGAGCGTTACTAACCCCTTGTGCATTGGTGTGGGCTTGGAGGATGTGGATTTGATCGTGTCC
AATTTCTTTGGAGCAGTTCTGAACGTAGCCTCTTTGCAACATCATAGAXTTGTTACCGTAAGTAGGATGGGATGGCTAGCTGAGCCAGGT
CTCGCTAGCATTGXTGTAGATGCAACTGTTTTGGTTGGCAACGGGGTAAATATCTCTCCGTTTTCCATTATCACAAGGCAATTTCGCATT
ATTATTTTTCCACACAGTTATAGAXTTATTAGGGGAAATATTTTGCATTACCTAAATTCTAGAGTCATAGCTCAATGCTTTCCATGTCTG
AGATTGGCTCATAGGGCAGATGAGTTGGTAAAACATGGAGGTCCACGAATTGAAAATGAAGAGAAATGCCTNGAGAAATACGCCGTGATC
GTGAACTGGCCTCGAGCTCAATATTTTCAACCTTATCTTTCAGAATCAAGTTACGTTTAG
Edits in Original Sequence 
(5')GAAAAGGTCGTGACCAATTCCCAAACACCAATTTTAGATGTTCTGTcTGTCATTCAGAGCTCAGAAACTCAAGAACGAACCTCGAC
CATGGGTGCATGTGTCGAGATTGGAAGTTCAGGGAGTTCAGAGCAAGGATACTGCTTTGGAAGCXGGTAGCTTCTTTAGAGATTATGTGG
ATAATGTAAGTTCCATTGATGAGTGCCTAGCTGCAGGAGTATCACCCAAGAAAATCGAGGTTTGTATGGGTGGTAAATGCAAGAAATCGG
GTGCTGCAGCXGCTTCTGGGGGAACTTCAAAGGCTaGTTGGCATTGAAGGAGCTGTCTCCGGATGCAAGTGCATGGGCAAATGTAGAGAT
GGTCCTAATGTGAGGATTCTCAAGGGTCCTTCTGAGAGCGTTACTAACCCCTTGTGCATTGGTGTGGGCTTGGAGGATGTGGATTTGATC
GTGTCCAATTTCTTTGGAGaCAGTTCTGAACGTAGCCTCTTTGCAACATCATAGAXTTGTTACCGTAAGTAGGATGGGATGGCTAGCTGA
cGCCAGGTCTCGCTAGCATTGXTGTAGATGCAACTGTTTTGGTTGGCAACGGGGTAAATATCTCTCCGTTTTCCATTATCACAAGGCAAT
TTCGCATTATTATTTTTCCACACAGTTATAGAXTTATTAGGGGAAATATTTTGCATTACCTAAATTCTAGAGTCATAGCTCAATGCTTTC
CATGTCTGAGtATTGGCTCATAGGGCAGATGAGTTGGTAAAACATGGAGGTCCACGAATTGAAAATGAAGAGAAATGCCTNGAGAAATAC
GCCGTGATCGTGAACTGGCCTCGAGCTCAATATTTTCAACCTTATCTTTCAGAATCAAGTTACGTTTAG(3')TGCAAAGAGGTGGTTAA
TGACATGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan