ESTScan Details for Unigene SGN-U303819

Score 
486
Direction 
Reverse
Predicted Peptide Sequence 
MEAFETKWDNHLETKKLIIATETRVLSAAADSAPCFAAATIPIEAREKTCNTISSALTPLYARXATPAADCVTPVPVQKLLSGGVGGRAP
VYFVPPVNLTIAILVYHLLKPTTRASAFVGTKQAYASLRTQIPLSSAPPHGEDINLNLELDFGSDEISSAEQYDXIQTPKFLGEVNINLL
LPGLTGIHRNTKSIFFTGLGVDGFSVVPAGEADILSGLPPNDPEE
Predicted Coding Sequence 
ATGGAAGCTTTTGAAACAAAGTGGGATAACCACTTGGAAACCAAAAAGCTGATAATAGCCACTGAGACCAGAGTGCTTTCTGCTGCTGCG
GATAGTGCACCCTGTTTTGCAGCAGCAACAATTCCAATTGAAGCAAGAGAGAAGACTTGCAACACAATCTCTAGTGCATTGACCCCTTTA
TATGCTAGAXTTGCAACTCCTGCAGCTGACTGTGTGACTCCAGTACCTGTCCAGAAGCTGCTCTCTGGCGGAGTGGGTGGGAGAGCTCCA
GTGTACTTTGTTCCXCCAGTCAATTTGACCATTGCTATACTTGTTTACCACCTTCTGAAGCCCACCACAAGGGCATCTGCCTTTGTAGGA
ACAAAGCAAGCTTATGCCAGTTTAAGGACCCAAATTCCTTTATCTTCCGCTCCTCCACATGGAGAAGATATAAATCTGAATCTAGAACTA
GATTTTGGTTCAGATGAAATATCCAGCGCGGAACAATACGATXCTATCCAGACGCCAAAATTCCTTGGTGAGGTAAATATCAATCTGCTA
TTGCCCGGGCTAACTGGAATACACAGGAACACCAAAAGTATCTTCTTCACCGGCTTAGGTGTGGATGGATTCTCTGTGGTTCCAGCTGGT
GAAGCAGATATATTATCTGGATTGCCTCCTAATGACCCGGAGGAATAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTNTNNGATATAAAAACCTTTGGTCTTTCTTATTAATGTCTGCACCAGACTCTACGCGAATGTGTGTACTTA
GAATTATGTATCTAAATGCTTCCAAGTGATACACGTACGAAGACACTGATAAATATTTTTCCTGTCATCTCTTTCATCTAAAACTCTGGT
TAAGTAGCTGACACATGTATCTCAGCGCGATGCGTGATCATAATCATGAAA
(5')ATGGAAGCTTTTGtAAACAAAGTGGGATAACCACT
TGGAAACCAAAAAGCTGATAATAGCCACTGAGACCAGAGTGCTTTCTGCTGCTGCGGATAGTGCACCCTGTTTTGCAGCAGCAACAATTC
CAATTGAAGCAAGAGAGAAGACTTGCAACACAATCTCTAGTGCATTGACCCCTTTATATGCTAGAXTTGCAACTCCTGCAGCTGACTGTG
TGACTCCAGTACCTGTCCAGAAGCTGCTCTCTaGGCGGAGTGGGTGGGAGAGCTCCAGTGTACTTTGTTCCXCCAGTCAATTTGACCATT
GCTATACTTGTTTaACCACCTTCTGAAGCCCACCACAAGGGCATCTGCCTTTGTAGGAACAAAGCAAGCtTTATGCCAGTTTAAGGACCC
AAATTCCTTTATCTTCCGCTCCTCCACATGGAGAAGATATAAATCTGAATCTAGAACTAGATTTTGGTTCAGATGAAATATCCAGCGCGG
AACAATACGATXCTATCCAGACGCCAAAATTCCTTGGTGAGGTAAATATCAATCTGCTATTGCCCGGGCTAACTGGAATACACAGGAACA
CCAAAAGTATCTTCTTCACCGGCTTAGGTGTGGATGGATTCTCTGTGGTTCCAGCTGGTGAAGCAGATATATTATCTGGATTGCCTCCTA
ATGACCCGGAGGAATAA(3')AAAACACAAGGTGGAATAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan