ESTScan Details for Unigene SGN-U304008

Score 
195
Direction 
Forward
Predicted Peptide Sequence 
LKYSQSSGINKDYFWLAKHFSNSHDRGVKSMTAYTFTVIDSFNPLDSYIWFELYGSPSDRDVDLLGSVIQSWYIMGRIGAFNSSNLQLAN
SSMEYDPLYDADKGFKVMPSSFHDISDVEFQDNWGRIWVDLGTSDFFSIDILLNCLTVLSSEYVGIQQVIFGGRKIGDWEEGMTSPEYXV
QILQNLKECLIWYFXVPLDESFILKMMALKAGKKNNTESCPFKHVLEHSTSWAILAF
Predicted Coding Sequence 
XATTTGAAGTACAGTCAATCCTCTGGAATAAACAAAGATTATTTTTGGTTGGCGAAACATTTTAGCAATTCTCATGACAGAGGTGTGAAG
TCTATGACTGCTTATACATTCACTGTTATTGACAGTTTTAATCCTCTTGACTCTTATATATGGTTTGAACTATATGGATCGCCATCTGAT
CGTGATGTTGACCTCCTCGGTAGTGTTATTCAATCCTGGTATATCATGGGTCGTATAGGCGCATTTAATTCATCTAATTTGCAGTTGGCA
AATTCATCAATGGAGTATGATCCTCTCTATGATGCAGATAAGGGCTTCAAGGTGATGCCTTCCTCATTCCATGACATAAGTGACGTTGAG
TTCCAGGACAACTGGGGAAGGATCTGGGTAGATCTTGGCACATCTGATTTCTTTTCCATAGATATTCTACTCAACTGCTTGACTGTTTTG
AGCTCAGAATATGTGGGCATTCAACAGGTAATCTTTGGCGGTCGCAAAATCGGTGACTGGGAAGAAGGAATGACCAGCCCTGAGTACGXG
GTACAAATTCTTCAAAATCTGAAAGAATGCTTAATATGGTACTTTGAXGTTCCTTTGGATGAAAGCTTTATCCTCAAGATGATGGCCTTA
AAAGCTGGAAAAAAGAACAACACAGAGAGTTGCCCATTTAAACATGTCCTTGAGCACTCTACTTCTTGGGCCATCCTTGCATTC
Edits in Original Sequence 
(5')XATTTGAAGTACAGTCtAATCCTCTGGAATAAACAAAGATTATTTTTGGTTGGCGAAACATTTTAGCAATTCTCATGACAGAGGTG
TGAAGTCTATGACTGCTTATACtATTCACTGTTATTGACAGTTTTAATCCTCTTGACTCTTATATATGGTTTGAACTATATGGATCGCCA
TCTGATCGTGATGTTGACCTCCTCGGTAGTGTTATTCAATCCTGGTATATCATGGGTCGTATAGGCGCATTTAATTCATCTAATTTGCAG
TTGGCAAATTCATCAATGGAGTATGATCCTCTCTATGATGCAGATAAGGGCTTCAAGGTGATGCCTTCCTCATTCCATGACATAAGTGAC
GTTGAGTTCCAGGACAACTGGGGAAGGATCTGGGTAGATCTTGGCACATCTGATTTCTTTTCCATAGATATTCTACTCAACTGCTTGACT
GTTTTGAGCTCAGAATATGTGGGCATTCAACAGGTAATCTTTGGCGGTCGCAAAATCGGTGACTGGGAAGAAGGAATGACCAGCCCTGAG
TACGXGGTACAAATTCTTCAAAATCTGAAAGAATGCTTAATATGGTACTTTGAXGTTCCTTTGGATGAAAGCTTTATCCTCAAGATGATG
GCCTTAAAAGCTGGAAAAAAGAACAACACAGAGAGTTGCCCATTTAAACATGTCCTTGAGCACTCTACTTCTTGGGCCATCCTTGCATTC
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan