ESTScan Details for Unigene SGN-U304018

Score 
247
Direction 
Reverse
Predicted Peptide Sequence 
PQREALAINGNRDLVVAITFLMPVFAHCMAKXPVAYHDEEEVSPNILMDKSKKKATXPDFSINAAKRFFQSETASSPLTPHISVLFSGSL
ETDRYWIDDATDSKWILFAGCRLKHHVATLTNHALVTLSLKLLASVLKYESFPWDCIKSFCTDEGSILLAKASLRCTTLFKAETLPSGCV
LQQT
Predicted Coding Sequence 
CCACAACGAGAAGCTTTAGCAATAAATGGAAATCGTGATCTTGTAGTAGCAATAACTTTCCTGATGCCTGTATTTGCTCATTGTATGGCT
AAAXCACCTGTTGCTTACCACGATGAAGAGGAAGTCTCACCAAACATCTTGATGGACAAATCGAAGAAGAAAGCTACTAXCCCTGATTTC
TCCATCAATGCAGCAAAGCGCTTTTTCCAATCTGAGACAGCCTCTTCACCATTAACCCCTCATATATCAGTCCTGTTCTCCGGTTCCCTT
GAAACAGATAGGTATTGGATAGATGATGCTACAGACTCTAAATGGATTCTTTTTGCTGGATGTAGGTTGAAGCATCACGTAGCAACCCTT
ACTAACCACGCGCTAGTTACTCTTTCCTTAAAGCTCCTAGCCTCAGTTCTCAAATATGAATCCTTTCCCTGGGACTGCATCAAGAGCTTC
TGCACAGATGAAGGCAGCATCCTCCTTGCTAAGGCTTCCTTGCGTTGCACAACCCTTTTCAAAGCTGAAACGCTGCCTTCCGGGTGTGTT
CTTCAGCAAACX
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTAAAT(5')CCACAACGAGAAGCTTTAGCAATAAATGGAAATCGTGATCTTGTAGTAGCAATAACTTTCCT
GATGCCTGTATTTGCTCATTGTATGGCTAAAXCACCTGTTGCTTACCACGATGAAGAGGAAGTCTCACCAAACATCTTGATGGACAAATC
GAAGAAGAAAGCTACTAXCCCTGATTTCTCCATCAATGCAGCAAAGCGCTTTTTCCAATCTGAGACAGCCTCTTCACCATTAACCaCCTC
ATATATCAGTCCTGTTCTCCGGTTCCCTTGAAACAGATAGGTATTGGATAGATGATGCTACAGACTCTAAATGGATTCTTTTTGCTGGAT
GTAGGTTGAAGCATCACGTAGCAtACCCTTACTAACCACGCGCTAGTTACTCTTTCCTTAAAGCTCCTAGCCTCAGTTCTCAAATATGAA
TCCTTTCCCTGGGACTGCATCAAGAGCTTCTGCACAGATGAAGGCAGCATCCTCCTTGCTAAGGCTTCCTTGCGTTGCACAACCCTTTTC
AAAGCTGAAACGCTGCCTTCCGGGTGTGTTCTTCAGCAAACX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan