ESTScan Details for Unigene SGN-U304200

Score 
752
Direction 
Forward
Predicted Peptide Sequence 
PTPTSVLGLPIGQHISCRGKDGQGEEVIKPYTPTTLDSDVGYFELVIKMYPQGRMSHHFRELRVGDYLAVKGPKGRFRYQPGQVRAFGML
AGGSGITPMFQVARAILENPNDKTNVHLIYANVTYEDILLKEELESLTANYAGRFKVYYVLNQPPEVWNGGVGFVSKEMIQEHCPSPASD
IKVLRCGPPPMNKAMAAHLEALGYTPEMQFQF
Predicted Coding Sequence 
CCCACGCCCACCTCCGTGTTGGGACTTCCCATTGGACAGCATATAAGTTGCAGGGGTAAGGATGGTCAAGGGGAAGAGGTCATAAAACCA
TATACTCCAACCACATTGGACTCGGATGTTGGATACTTTGAATTAGTTATAAAGATGTATCCTCAAGGAAGGATGTCTCACCATTTCCGT
GAACTGCGTGTTGGAGATTATTTGGCTGTTAAAGGACCCAAGGGTCGTTTTAGATATCAACCGGGACAAGTTAGAGCATTTGGAATGCTT
GCTGGAGGCTCTGGCATCACCCCAATGTTTCAGGTTGCCAGAGCTATTTTAGAAAACCCAAATGACAAAACAAATGTACATCTCATCTAT
GCTAATGTTACCTATGAGGACATTCTTTTGAAGGAAGAGTTGGAGTCTTTGACTGCTAATTATGCTGGCCGTTTCAAAGTTTACTATGTC
CTCAATCAGCCTCCAGAAGTATGGAATGGTGGTGTTGGCTTCGTCTCTAAGGAAATGATTCAAGAGCATTGCCCTTCACCTGCATCTGAC
ATTAAGGTATTGAGATGTGGACCTCCACCAATGAACAAGGCTATGGCAGCTCATCTTGAAGCTCTTGGTTACACCCCAGAGATGCAATTC
CAATTTTAA
Edits in Original Sequence 
(5')CCCACGCCCACCTCCGTGTTGGGACTTCCCATTGGACAGCATATAAGTTGCAGGGGTAAGGATGGTCAAGGGGAAGAGGTCATAAA
ACCATATACTCCAACCACATTGGACTCGGATGTTGGATACTTTGAATTAGTTATAAAGATGTATCCTCAAGGAAGGATGTCTCACCATTT
CCGTGAACTGCGTGTTGGAGATTATTTGGCTGTTAAAGGACCCAAGGGTCGTTTTAGATATCAACCGGGACAAGTTAGAGCATTTGGAAT
GCTTGCTGGAGGCTCTGGCATCACCCCAATGTTTCAGGTTGCCAGAGCTATTTTAGAAAACCCAAATGACAAAACAAATGTACATCTCAT
CTATGCTAATGTTACCTATGAGGACATTCTTTTGAAGGAAGAGTTGGAGTCTTTGACTGCTAATTATGCTGGCCGTTTCAAAGTTTACTA
TGTCCTCAATCAGCCTCCAGAAGTATGGAATGGTGGTGTTGGCTTCGTCTCTAAGGAAATGATTCAAGAGCATTGCCCTTCACCTGCATC
TGACATTAAGGTATTGAGATGTGGACCTCCACCAATGAACAAGGCTATGGCAGCTCATCTTGAAGCTCTTGGTTACACCCCAGAGATGCA
ATTCCAATTTTAA(3')TTTTGTCACAAATTTAGCCCTACACATGGTTTCATTGTTAGTGTGGGGGGAACAGAATTTTTCATGTTGGAAT
AGCAGGGGAAATGAATCATGTAATGCAAATTGTTGACGTTGTTCCTGTGAACTTGGAGCAATAAAATTTCCCAGAAGTTTATGACTGTCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan