ESTScan Details for Unigene SGN-U304286

Score 
245
Direction 
Forward
Predicted Peptide Sequence 
TRPLFIKLPDGYVQEAANPIWEYHKYIPYSKPEKKVHDQILLYGTPKDLDDFCLKAQLVNYIQYRALLEGWTSRMWSKYTGVLSGKLIIP
GQVSGANSMIISMTKQQGSMAVAXAAKPIHVQLNLATYYIEVVNTTSGELSSVAIEASVWNLDGMCPYYEVSEKLTVPSKRTVPIFEMKY
PKSKNAKPVYFLLLKLYNISDYGILSRNLYWLHLPGGDYKLLEPYRNKKVPLKITS
Predicted Coding Sequence 
XGCACCAGGCCTTTGTTTATAAAGCTGCCAGATGGCTATGTACAGGAAGCTGCAAATCCCATATGGGAATACCACAAGTACATTCCATAT
TCAAAACCAGAGAAGAAGGTTCATGATCAGATTTTGCTTTATGGGACCCCAAAAGATCTTGATGATTTTTGTCTTAAGGCACAACTAGTT
AATTATATCCAGTATAGAGCTCTCTTAGAAGGCTGGACCTCGCGTATGTGGAGCAAGTATACAGGAGTTTTATCTGGAAAACTCATAATC
CCTGGACAGGTCTCCGGGGCCAATTCTATGATCATCTCCATGACCAAACAGCAGGGTTCTATGGCTGTCGCTGXTGCTGCAAAACCTATC
CATGTTCAACTTAATCTGGCAACATATTACATCGAGGTGGTTAATACTACATCTGGTGAACTCTCTAGTGTGGCTATAGAAGCCTCCGTG
TGGAATCTGGATGGGATGTGCCCATATTATGAAGTGTCTGAAAAGCTCACCGTACCATCTAAAAGAACAGTACCTATCTTTGAGATGAAA
TATCCCAAGTCTAAAAATGCAAAGCCAGTTTACTTCCTCCTCCTTAAACTGTATAACATATCGGACTATGGCATATTGTCCAGGAACTTG
TACTGGTTGCATTTACCAGGTGGTGATTACAAGCTCTTGGAACCCTACAGGAATAAGAAAGTGCCACTTAAAATAACATCT
Edits in Original Sequence 
(5')XGCACCAGGCCTTTGTTTATAAAGCTGCCAGATGGCTATGTACAGGAAGCTGCAAATCCCATATGGGAATACCACAAGTACATTCC
ATATTCAAAACCAGAGAAGAAGGTTCATGATCAGATTTTGCTTTATGGGACCCCAAAAGATCTTGATGATTTTTGTCTTAAGGCACAACT
AGTTAATTATATCCAGTATAGAGCTCTCTTAGAAGGCTGGACCTCGCGTATGTGGAGCAAGTATACAGGAGTTTTaATCTGGAAAACTCA
TAATCCCTGGACAGGTCTCCGGGGCCAATTCTATGATCATCTCCATGACCAAACAGCAGGGTTCTATGGCTGTCGCTGXTGCTGCAAAAC
CTATCCATGTTCAACTTAATCTGGCAACATATTACATCGAGGTGGTTAATACTACATCTGGTGAACTCTCTAGTGTGGCTATAGAAGCCT
CCGTGTGGAATCTGGATGGGATGTGCCCATATTATGAAGTGTCTGAAAAGCTCACCGTACCATCTAAAAGAACAGTACCTATCTTTGAGA
TGAAATATCCCAAGTCTAAAAATGCAAAGCCAGTTTACTTCCTCCTCCTTAAACTGTATAACATATCGGACTATGGCATATTGTCCAGGA
ACTTGTACTGGTTGCATTTACCAGGTGGTGATTACAAGCTCTTGGAACCCTACAGGAATAAGAAAGTGCCACTTAAAATAACATCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan