ESTScan Details for Unigene SGN-U304401

Score 
414
Direction 
Forward
Predicted Peptide Sequence 
PDPIKCGFSAFQCTSAASFPTFYHSGTRPPAGPGHSFLQGQPPHPIQAPLQPPYQVGGSQLGTDFNQIASSNQADRGSPWIPGMKQESAS
AAQLSGQPQFPGQMGTGNQQPRPPSLTPEMEKALLQQVMSLTPEQINQLPPEQRNQXVAVAANAASIRAFVIEALDRALWDFANXVASLA
VR
Predicted Coding Sequence 
XXCCCAGATCCTATTAAATGTGGGTTTTCAGCATTCCAGTGCACCTCAGCTGCATCCTTCCCAACCTTCTATCATTCAGGCACAAGACCT
CCAGCTGGTCCTGGGCATTCATTTCTGCAGGGACAACCTCCACATCCAATTCAGGCCCCATTACAGCCACCATATCAGGTTGGAGGCTCA
CAATTAGGGACGGACTTCAATCAAATTGCAAGCTCCAATCAAGCTGATAGGGGATCTCCTTGGATTCCTGGAATGAAACAAGAGAGTGCT
TCTGCGGCACAGCTTTCAGGACAACCACAATTCCCTGGCCAAATGGGCACAGGCAATCAGCAGCCTCGACCTCCTTCGTTGACGCCTGAG
ATGGAAAAGGCCTTACTTCAACAGGTCATGAGCCTCACTCCAGAGCAGATTAACCAGCTACCTCCAGAACAGAGGAATCAAGXTGTTGCA
GTTGCAGCAAATGCTGCGTCCATAAGAGCTTTCGTGATAGAAGCATTAGATCGTGCTCTTTGGGATTTTGCCAACTAXGTGGCGTCTCTG
GCTGTTCGTTAG
Edits in Original Sequence 
(5')XXCCCAGATCCTATTAAATGTGGGTTTTCAGCATTCCAGTGCACCTCAGCTGCATCCTTCCCAACCTgTCTATCATTCAGGCACAA
GACCTCCAGCTGGTCCTGGGCATTCATTTCTGCAGGGACAACCTCCACATCCAATTCAGGCCCCATTACAGCCACCATATCAGGTTGGAG
GCTCACAATTAGGGACGGACTTCAATCAAATTGCAAGCTCCAATCAAGCTGATAGGGGATCTCCTTGGATTCCTGGAATGAAACAAGAGA
GTGCTTCTGCGGCACAGCTTTCAGGACAACCACAATTCCCTGGCCAAATGGGCACAGGCAATCAGCAGCCTCGACCTCCTTCGTTGACGC
CTGAGATGGAAAAGGCCTTACTTCAACAGGTCATGAGCCTCACTCCAGAGCAGATTAACCAGCTACCTCCAGAACAGAGGAATCAAGXTG
TTGCAGTTGCAGCAAATGCTGCGTCCATAAGAGCTTTCGTGATAGAAGCATTAGATCGTGCTCTTTGGGATTTTGCCAACTAXGTGGCGT
CTCTGGCTGTTCGTTAG(3')GCTATTTATCAATCAATATATGGCATGGAGAAACAATGCTGTTGCCAAATGTCTGGCATATGTATATTA
TCGTTTCATTTTGTCTTATTTTATGCATCAGAAAAAGTTATTGCATTTTTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan