ESTScan Details for Unigene SGN-U304545

Score 
268
Direction 
Forward
Predicted Peptide Sequence 
RMVKVKGPKRSIYVSFFHFWGSIVLKFKLKXFGEVVAGGSSSVSSLRAELLTVRRKEEKGAISCFKLVSCWALSESPXNSRRERNARAAL
FDGIEEGGIRASSSYSSHEIDEQENEKEIDGLQDRVNLLKRLSGDIHEEVDNHNRMLDRMGNDMDASRGILAGTVDKFKMVFETKSSRRM
LTLVASFVVIFLVVYYLTK
Predicted Coding Sequence 
XGAAGAATGGTTAAAGTTAAGGGACCAAAAAGGTCAATTTACGTTTCCTTTTTCCATTTTTGGGGTTCAATTGTTCTTAAATTTAAGTTG
AAAGXTTTCGGTGAAGTGGTAGCCGGTGGTTCTTCTTCCGTGTCAAGTCTCCGTGCTGAATTACTAACCGTCCGTAGGAAAGAAGAAAAA
GGGGCAATTAGTTGCTTCAAACTCGTGAGCTGCTGGGCATTGTCTGAATCTCCAXTGAATTCTCGAAGGGAGCGTAATGCTAGAGCTGCA
CTTTTTGATGGCATTGAAGAAGGTGGCATCAGGGCTTCATCTTCTTACTCCTCTCATGAAATTGATGAGCAGGAGAATGAAAAAGAAATT
GATGGGTTACAGGATCGAGTTAATCTGCTGAAAAGATTGTCTGGTGATATACATGAGGAAGTGGACAATCATAACCGCATGCTGGACAGA
ATGGGTAACGATATGGATGCTTCAAGGGGAATCTTAGCAGGAACAGTGGACAAATTTAAAATGGTATTTGAGACCAAATCAAGCAGGAGA
ATGCTTACACTAGTGGCATCATTTGTGGTCATTTTCCTGGTTGTATACTACCTCACTAAGTAA
Edits in Original Sequence 
(5')XGAAGAATGGTTAAAGTTAAGGGACCAAAAAGGTCAATTTACGTTTCCTTTTTCCATTTTTcGGGGTTCAATTGTTCTTAAATTTA
AGTTGAAAGXTTTCGGTGAAGTGGTAGCCGGTcGGTTCTTCTTCCGTGTCAAGTCTCCGTGCTGAATTACTAACCGTaCCGTAGGAtAAG
AAGAAAAAGGGGCAATTAGTTGCTTCAAACTCGTGAGCTGCTGGGCATTGTCTGAATCTCCAXTGAATTCTCGAAGGGAGCGTAATGCTA
GAGCTGCACTTTTTGATGGCATTGAAGAAGGTGGCATCAGGGCTTCATCTTCTTACTCCTCTCATGAAATTGATGAGCAGGAGAATGAAA
AAGAAATTGATGGGTTACAGGATCGAGTTAATCTGCTGAAAAGATTGTCTGGTGATATACATGAGGAAGTGGACAATCATAACCGCATGC
TGGACAGAATGGGTAACGATATGGATGCTTCAAGGGGAATCTTAGCAGGAACAGTGGACAAATTTAAAATGGTATTTGAGACCAAATCAA
GCAGGAGAATGCTTACACTAGTGGCATCATTTGTGGTCATTTTCCTGGTTGTATACTACCTCACTAAGTAA(3')TTGGGGTTGAGAGCC
GGTGCATTTTCTAGAACCATGCACAGAACTTCCTGGCATCTTTCCTGATCATATGTACTTGTATACAAGAATAGCAGTGCTTTCTTCACT
TTGTTAATGTAATGAACACCAGCACCAGTTGTAAGATGTTGCCATATGCATGCCTATGTAAAAAATGTTTTGGTGCACTGACCTTTGAAC
GTGTGCAATGACTATTACTATCCTGCGCTACACCTTTGATGGAATATGCACGCATTTTTCANNNNAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan