Notice: Please give us important feedback on the future of SGN using this survey: https://www.surveymonkey.com/r/VJTRHVC

ESTScan Details for Unigene SGN-U304765

Score 
866
Direction 
Forward
Predicted Peptide Sequence 
QKHKTQHATHNTATNRRGRRRSRAAMANMIMASSKALITCSSTIPPTPKLKLSPVQLSFPKLPLSNVPKPHQLLSLPNSISVILAASLAM
APPSLAAEIEKAALFDFNLTLPIIAAEFLLLMVALDKIYFTPLGKFMDERDAAIREKLSSVKDTSGEVKQLEAQAAATMRAARAEISAAL
NKMKKETQLEVEQKLAEGRKKVEAELQEALASLEKQKEDTIRALDSQIAALSDEIVKKVLPAR
Predicted Coding Sequence 
CAGAAACATAAAACTCAGCACGCAACACATAATACTGCAACTAACAGAAGAGGAAGAAGGCGAAGCAGAGCTGCCATGGCCAACATGATC
ATGGCCTCCTCCAAAGCCCTAATCACTTGCTCTTCAACCATTCCCCCCACCCCTAAACTCAAGCTCTCCCCAGTTCAACTATCTTTCCCT
AAACTACCCCTTTCCAATGTCCCCAAGCCTCACCAACTCCTGTCCCTTCCGAACTCCATTTCTGTAATTCTTGCAGCCTCCCTGGCCATG
GCACCCCCTTCCCTAGCTGCGGAAATCGAAAAGGCCGCGCTTTTCGACTTCAACTTAACACTCCCCATCATAGCAGCGGAGTTCTTGCTC
CTCATGGTCGCCCTTGACAAGATTTACTTCACGCCATTAGGCAAATTCATGGACGAAAGGGATGCAGCCATCAGGGAGAAGCTGAGCAGC
GTCAAGGACACTTCTGGGGAGGTGAAACAGCTTGAAGCCCAAGCCGCCGCCACCATGAGAGCTGCCAGGGCTGAGATATCGGCTGCCCTG
AACAAGATGAAGAAGGAGACTCAGCTGGAAGTGGAGCAGAAGTTGGCTGAGGGGAGAAAGAAAGTGGAAGCTGAGTTGCAAGAAGCCTTG
GCTAGTTTGGAAAAGCAAAAAGAAGACACCATTAGGGCTCTTGATTCTCAGATTGCTGCTCTTAGTGATGAGATTGTCAAGAAGGTCCTC
CCTGCACGTTGA
Edits in Original Sequence 
(5')CAGAAACATAAAACTCAGCACGCAACACATAATACTGCAACTAACAGAAGAGGAAGAAGGCGAAGCAGAGCTGCCATGGCCAACAT
GATCATGGCCTCCTCCAAAGCCCTAATCACTTGCTCTTCAACCATTCCCCCCACCCCTAAACTCAAGCTCTCCCCAGTTCAACTATCTTT
CCCTAAACTACCCCTTTCCAATGTCCCCAAGCCTCACCAACTCCTGTCCCTTCCGAACTCCATTTCTGTAATTCTTGCAGCCTCCCTGGC
CATGGCACCCCCTTCCCTAGCTGCGGAAATCGAAAAGGCCGCGCTTTTCGACTTCAACTTAACACTCCCCATCATAGCAGCGGAGTTCTT
GCTCCTCATGGTCGCCCTTGACAAGATTTACTTCACGCCATTAGGCAAATTCATGGACGAAAGGGATGCAGCCATCAGGGAGAAGCTGAG
CAGCGTCAAGGACACTTCTGGGGAGGTGAAACAGCTTGAAGCCCAAGCCGCCGCCACCATGAGAGCTGCCAGGGCTGAGATATCGGCTGC
CCTGAACAAGATGAAGAAGGAGACTCAGCTGGAAGTGGAGCAGAAGTTGGCTGAGGGGAGAAAGAAAGTGGAAGCTGAGTTGCAAGAAGC
CTTGGCTAGTTTGGAAAAGCAAAAAGAAGACACCATTAGGGCTCTTGATTCTCAGATTGCTGCTCTTAGTGATGAGATTGTCAAGAAGGT
CCTCCCTGCACGTTGA(3')GATGGATTTTAGGCTCACTGGGTTTTGATTTGATCTTACAATCTGTACTTGTAATCCACGATGATGAGGT
TAACTTGGGTTTTAGTGTGAAAATTCATTCTTCTTGATTTCGATACAATGGCCTTTCGTACTTGCGAGTTTTTGGCCTTTTAAAAAAAAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan