ESTScan Details for Unigene SGN-U304881

Score 
131
Direction 
Forward
Predicted Peptide Sequence 
PVIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLDKTIVLRPLEPAPIQHLAREFMVKTRRRKXVTSSPHSILQDILKKTLIEMILV
FFA
Predicted Coding Sequence 
CCTGTGATTGAATCATTTGGCTTTGAGACAGACTTGAGGTATCACACTCAAGGGCAAGCATTTTGTCTCTCCGTGTTTGACCATTGGGCT
ATTGTTCCTGGGGATCCTCTGGACAAGACCATAGTTCTACGACCACTTGAACCTGCACCTATTCAACATTTGGCTCGTGAGTTCATGGTG
AAGACACGGCGTAGAAAGGXTGTGACCTCTTCTCCTCATTCCATCTTACAAGATATTCTTAAGAAGACATTGATTGAAATGATTTTAGTG
TTCTTTGCX
Edits in Original Sequence 
GCTTGAAACTGTATTCTGTAGTGTTTAAAACAAAGGGTACTCAGAGCTTACCCTCATATATATGTTGTTTGCTGCTATTTGTATATGACT
TCTTGTCTTTCCAGTTGGTTATACTTGTTTGCAATGCAACACTGTACTGTGGGTGAATTTATTTGACCTCTTTCTTTTATGGGGCTGTAG
GCATTTTTA
(5')CCTGTGATTGAATCATTTGGCTTTGAGACAGACTTGAGGTATCACACTCAAGGGCAAGCATTTTGTCTCTCCGTGTT
TGACCATTGGGCTATTGTTCCTGGGGATCCTCTGGACAAGACCATAGTTCTACGACCACTTGAACCTGCACCTATTCAACATTTGGCTCG
TGAGTTCATGGTGAAGACACGGCGTAGAAAGGXTGTGACCTCTTCTCCTCATTCCATCTTACAAGATATTCTTAAGAAGACATTGATTGA
AATGATTTTAGTGTTCTTTGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan