Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U304924

Score 
440
Direction 
Forward
Predicted Peptide Sequence 
EKDTLFIAKEGKGVPLWRIATLPLXGVLGDPKQAIFGVFDGHGGAKAAEFAAKNLNKNIMNEVARRSGECIEVAISEGYLTTDAECLKED
ISGGTCCVTALIQRGNLVVSNAGDCRAVLSRGGVAEALTVDQGLPGRTKERELRAWVAMWIVAMVFGEYRDXLAVSRGLGDRHLKPWVIP
KPDTKIVEIRPECEFLIMASDGLWDKVSNQEAVDVVRPLCMNVVDNSDRHAACRKLVDLSVERGSTDDISVMLIQLGHFIPSVMQGAEXN
LGIEYKGNCKVIKHMGEIKRCATMGTIEAGISTLTTMAYRVYTAHLDFHHCFYTPLQVNEAMQLDTNSKFHTSTYSGEEKFASSSVGHLA
FLVSELSAKINVLSVDSFSPLVVVWGFAPDTIMYQLLSVIIARCKCNVNADXNQSKP
Predicted Coding Sequence 
XXGGAGAAGGATACGCTGTTTATTGCAAAAGAGGGAAAAGGCGTGCCCCTATGGAGGATCGCCACTCTGCCGCTTXCTGGAGTCCTAGGA
GACCCTAAGCAGGCTATCTTTGGAGTATTTGATGGGCATGGAGGAGCAAAAGCTGCAGAATTTGCAGCTAAGAATTTAAATAAGAATATC
ATGAATGAAGTGGCTAGGAGAAGTGGAGAATGCATTGAAGTGGCTATTAGTGAGGGATATCTCACTACAGATGCAGAGTGTTTGAAAGAA
GATATCAGTGGGGGGACTTGCTGCGTGACAGCATTGATACAGCGAGGCAATCTTGTGGTATCAAACGCTGGAGACTGTCGTGCTGTTTTG
AGCCGGGGCGGAGTTGCAGAGGCATTGACAGTTGATCAAGGCCTTCCAGGCAGGACGAAAGAGAGAGAATTGAGGGCCTGGGTGGCTATG
TGGATTGTTGCCATGGTGTTTGGAGAATACAGGGATCXTCTTGCTGTATCAAGAGGACTCGGTGATCGCCATCTTAAACCGTGGGTGATA
CCAAAACCAGATACTAAGATCGTAGAGATCAGACCGGAATGCGAATTTCTAATCATGGCCTCTGATGGCCTTTGGGACAAGGTTAGCAAC
CAAGAGGCTGTAGATGTAGTTCGACCTCTATGTATGAATGTAGTTGACAATTCAGATCGACATGCTGCTTGCAGAAAGCTTGTCGATTTG
TCAGTGGAGAGAGGCTCTACGGATGATATCAGTGTCATGTTGATTCAGTTAGGTCATTTTATTCCATCAGTTATGCAAGGGGCTGAAGXT
AATTTGGGTATAGAATACAAAGGCAACTGCAAGGTGATTAAGCACATGGGTGAGATCAAGCGGTGCGCCACCATGGGAACCATTGAGGCT
GGAATTAGTACATTGACAACAATGGCATACCGTGTATATACTGCACATTTGGATTTCCACCATTGTTTTTATACTCCATTGCAAGTAAAT
GAAGCTATGCAATTGGACACAAATTCCAAATTTCATACTAGTACATACAGTGGAGAAGAGAAATTTGCCTCTTCTTCAGTTGGTCATTTG
GCTTTTTTGGTTTCTGAGTTGTCCGCTAAGATAAATGTGCTATCAGTTGATTCTTTTTCCCCTTTGGTCGTTGTTTGGGGGTTTGCTCCA
GACACAATAATGTATCAGCTATTATCAGTGATAATTGCACGGTGCAAGTGCAATGTAAACGCTGATXATAACCAAAGTAAACCTTAA
Edits in Original Sequence 
(5')XXGGAGAAGGATACGCTGTTTATTGCAAAAGAGGGAAAAGGCGTGCCCCTATGGAGGATCGCCACTCTGCCGCTTXCTGGAGTCCT
AGGAGACCCTAAGCAGGCTATCTTTGGAGTATTTGATGGGCATGGAGGAGCAAAAGCTGCAGAATTTGCAGCTAAGAATTTAAATAAGAA
TATCATGAATGAAGTGGCTAGGAGAAGTGGAGAATGCATTGAAGTGGCTATTAGTGAGGGATATCTCACTACAGATGCAGAGTGTTTGAA
AGAAGATATCAGTGGGGGGACTTGCTGCGTGACAGCATTGATACAGCGAGGCAATCTTGTGGTATCAAACGCTGGAGACTGTCGTGCTGT
TTTGAGCCGGGGCGGAGTTGCAGAGGCATTGACAGTTGATCAcAGGCCTTCCAGGCAGGACGAAAGAGAGAGAATTGAGGGCCTGGGTGG
CTATGTGGATTGTTGCCATGGTGTTTGGAGAATACAGGGATCXTCTTGCTGTATCAAGAGGACTCGGTGATCGCCATCTTAAACCGTGGG
TGATACCAAAACCAGATACTAAGATCGTAGAGATCAGACCGGAATGCGAATTTCTAATCATGGCCTCTGATGGCCTTTGGGACAAGGTTA
GCAACCAAGAGGCTGTAGATGTAGTTCGACCTCTATGTATGAATGTAGTTGACAATTCAGATCGACATGCTGCTTGCAGAAAGCTTGTCG
ATTTGTCAGTGGAGAGAGGCTCTACGGATGATATCAGTGTCATGTTGATTCAGTTAGGTCATTTTATTCCATCAGTTATGCAAGGGGCTG
AAGXTAATTTGGGTATAGAATACAAAGGCAACTGCAAGGTGATTAAGCACATGGGTGAGATCAAGCGGTGCGCCACCATGGGAACCATTG
AGGtCTGGAATTAGTACATTGACAACAATGGtCATACCGTGTATATACTGCACATTTGGATTTCCACCATTGTTTTTATACTCCATTGCA
AGTAAATGAAGCTATGCAATTGGACACAAATTCCAAATTTCATACTAGTACATACAGTcGGAGAAGAGAAATTTGCCTCTTCTTCAGTTG
GTCATTTGGCTTTTTTGGTTTCTGtAGTTGTCCGCTAAGATAAATGTGCTATCAGTTGATTCTTTTTCCCCTTTGGTCGTTGTTTGGGGG
TTTGCTCCAGACACAATAATGTATCAGCTATTATCAGTGATAATTGCACGGTGCAAGTGCAATGTAAACGCTGATXATAACCAAAGTAAA
CCTTAA(3')CATAAAAAAAATTTTCACTTGTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan