ESTScan Details for Unigene SGN-U305021

Score 
2207
Direction 
Forward
Predicted Peptide Sequence 
MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKINFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP
TGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
SEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTGAKVTKAAAKKGPNE
PVQVHAGRPSNEIYYYNKSRHANFSSAASVVLCMCYLLCRSFLPCMLVSLSQNWVLDRRWQILQN
Predicted Coding Sequence 
ATGGGTAAGGAAAAGGTTCATATCAACATTGTGGTCATTGGTCACGTCGACTCTGGAAAGTCGACCACTACTGGTCACTTGATCTACAAG
CTTGGAGGAATTGACAAGCGTGTGATTGAGAGGTTTGAGAAAGAAGCTGCTGAAATGAACAAGAGGTCATTCAAGTATGCTTGGGTGCTT
GACAAGCTTAAGGCTGAGCGTGAACGTGGTATCACCATTGATATTGCCTTGTGGAAGTTTGAGACCACAAAGTACTACTGCACTGTCATT
GATGCTCCTGGACATCGTGACTTTATCAAGAACATGATTACTGGTACTTCTCAGGCTGATTGTGCTGTCCTTATCATTGACTCCACCACT
GGTGGTTTTGAAGCTGGTATTTCTAAGGACGGTCAGACCCGCGAGCATGCTTTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATTTGC
TGCTGCAACAAGATGGATGCCACCACTCCCAAGTACTCCAAGGCACGTTATGATGAAATTGTGAAGGAAGTGTCTTCCTACTTGAAGAAG
GTCGGATACAATCCTGACAAAATAAACTTTGTCCCTATCTCTGGATTTGAGGGAGACAACATGATTGAGAGGTCTACCAATCTTGACTGG
TACAAGGGCCCAACCCTCCTTGAGGCTCTTGACCAGATCCAGGAGCCCAAGAGGCCTTCAGACAAGCCACTCCGTCTCCCACTTCAGGAT
GTGTACAAGATTGGTGGCATTGGAACCGTCCCTGTGGGACGTGTTGAAACAGGTGTTCTCAAGCCTGGTATGGTTGTGACCTTTGGTCCA
ACTGGTCTGACAACTGAAGTTAAGTCTGTTGAGATGCACCATGAAGCTCTTCAAGAGGCACTTCCTGGTGACAATGTTGGTTTCAATGTG
AAGAACGTTGCTGTGAAGGATCTCAAGCGTGGTTTTGTTGCTTCCAACTCCAAGGATGACCCAGCTAAGGGAGCTTCCAGCTTTACCTCC
CAGGTCATCATCATGAACCACCCAGGCCAAATTGGCAATGGATATGCCCCTGTCCTTGATTGCCACACTTCTCACATTGCTGTCAAGTTC
TCTGAGATCTTGACCAAGATTGACAGGCGATCTGGCAAGGAGCTTGAGAAGGAGCCCAAGTTCTTGAAGAATGGTGATGCTGGTTTTGTC
AAGATGATTCCCTCCAAGCCCATGGTTGTTGAAACTTTCTCAGAGTACCCTCCCCTTGGTCGTTTTGCTGTTAGGGACATGCGCCAAACT
GTTGCTGTTGGTGTTATCAAGGCTGTTGACAAGAAGGATCCTACTGGTGCCAAAGTCACCAAGGCTGCTGCTAAGAAGGGTCCAAATGAA
CCXGTGCAGGTTCATGCTGGTCGGCCCTCAAATGAAATCTACTACTACAATAAATCGCGTCATGCAAACTTTTCAAGTGCTGCTTCAGTA
GTTTTGTGTATGTGTTATTTGTTGTGTCGTAGTTTTCTGCCCTGTATGCTGGTTAGCCTCTCTCAGAATTGGGTGCTTGACAGACGGTGG
CAGATCCTACAGAACTGA
Edits in Original Sequence 
CTCTCTGCGGCAGCTCTCTCTCGCCTCCTGTCTTCGAGAAGTTTTCAGATTTTTAGCACTTCAGA(5')ATGGGTAAGGAAAAGGTTCAT
ATCAACATTGTGGTCATTGGTCACGTCGACTCTGGAAAGTCGACCACTACTGGTCACTTGATCTACAAGCTTGGAGGAATTGACAAGCGT
GTGATTGAGAGGTTTGAGAAAGAAGCTGCTGAAATGAACAAGAGGTCATTCAAGTATGCTTGGGTGCTTGACAAGCTTAAGGCTGAGCGT
GAACGTGGTATCACCATTGATATTGCCTTGTGGAAGTTTGAGACCACAAAGTACTACTGCACTGTCATTGATGCTCCTGGACATCGTGAC
TTTATCAAGAACATGATTACTGGTACTTCTCAGGCTGATTGTGCTGTCCTTATCATTGACTCCACCACTGGTGGTTTTGAAGCTGGTATT
TCTAAGGACGGTCAGACCCGCGAGCATGCTTTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATTTGCTGCTGCAACAAGATGGATGCC
ACCACTCCCAAGTACTCCAAGGCACGTTATGATGAAATTGTGAAGGAAGTGTCTTCCTACTTGAAGAAGGTCGGATACAATCCTGACAAA
ATAAACTTTGTCCCTATCTCTGGATTTGAGGGAGACAACATGATTGAGAGGTCTACCAATCTTGACTGGTACAAGGGCCCAACCCTCCTT
GAGGCTCTTGACCAGATCCAGGAGCCCAAGAGGCCTTCAGACAAGCCACTCCGTCTCCCACTTCAGGATGTGTACAAGATTGGTGGCATT
GGAACCGTCCCTGTGGGACGTGTTGAAACAGGTGTTCTCAAGCCTGGTATGGTTGTGACCTTTGGTCCAACTGGTCTGACAACTGAAGTT
AAGTCTGTTGAGATGCACCATGAAGCTCTTCAAGAGGCACTTCCTGGTGACAATGTTGGTTTCAATGTGAAGAACGTTGCTGTGAAGGAT
CTCAAGCGTGGTTTTGTTGCTTCCAACTCCAAGGATGACCCAGCTAAGGGAGCTTCCAGCTTTACCTCCCAGGTCATCATCATGAACCAC
CCAGGCCAAATTGGCAATGGATATGCCCCTGTCCTTGATTGCCACACTTCTCACATTGCTGTCAAGTTCTCTGAGATCTTGACCAAGATT
GACAGGCGATCTGGCAAGGAGCTTGAGAAGGAGCCCAAGTTCTTGAAGAATGGTGATGCTGGTTTTGTCAAGATGATTCCCTCCAAGCCC
ATGGTTGTTGAAACTTTCTCAGAGTACCCTCCCCTTGGTCGTTTTGCTGTTAGGGACATGCGCCAAACTGTTGCTGTTGGTGTTATCAAG
GCTGTTGACAAGAAGGATCCTACTGGTGCCAAAGTCACCAAGGCTGCTGCTAAGAAGGGTgCCAAATGAACCXGTGCAGGTTCATGCTGG
TCGGCCCTCAAATGAAATCTACTACTACAATAAATCGCGTCATGCAAACTTTTCAAGTGCTGCTTCAGTAGTTTTGTGTATGTGTTATTT
GTTGTGTCGTAGTTTTCTGCCCTGTATGCTGGTTAGCCTCTCTCAGAATTGGGTGCTTGACAGACGGTGGCAGATCCTACAGAACTGA(3')
GTCTTTGTGATCTCTGCTTTTGGATGTTNGTGGGTTGAGGTGCTTTGGAATGTATTACTATAATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan