Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U305201

Score 
105
Direction 
Forward
Predicted Peptide Sequence 
NARAVRGXGMKVSIRQLGPSMIQQMHHPCNECKGSGETINDKDAAHSARVIRLCRKILSCEPXAQQGMQNGQKITSPGEADEAPYTFTGD
IVFXPATERPSKIQALACMTCSYEPLLSLTEAL
Predicted Coding Sequence 
XXAAATGCCCGGGCTGTCAGGGGTXCTGGGATGAAAGTTTCTATTAGACAGCTTGGTCCGTCGATGATACAGCAGATGCACCATCCTTGT
AATGAGTGTAAAGGTTCTGGTGAAACTATTAACGACAAGGATGCTGCCCACAGTGCTAGGGTGATAAGGTTGTGCAGGAAAATATTGTCC
TGTGAACCTGNCGCACAGCAGGGTATGCAAAACGGGCAAAAAATTACCTCCCCTGGTGAAGCTGATGAAGCACCGTACACATTTACTGGG
GATATTGTCTTTGXTCCTGCAACGGAAAGACCATCCAAAATTCAAGCGCTAGCATGCATGACCTGTTCCTATGAGCCCCTTCTCTCCCTG
ACTGAGGCTCTX
Edits in Original Sequence 
(5')XXAAATGCCCGGGCTGTCAGGGGTXCTGGGATGAAAGTTTCTATTAGACAGCTTGGTCCGTCGATGATACAGCAGATGCACCATCC
TTGTAATGAGTGTAAAGGTTCTGGTGAAACTATTAACGACAAGGATcGCTGCCCACAGTGCTAGGGTGATAAGGTTGTGCAGGAAAATAT
TGTCCTGTGAACCTGNCGCACAGCAGGGTATGCAAAACGGGCAAAAAATTACCTCCCCTGGTGAAGCTGATGAAGCACCGTACACATTTA
CTGGGGATATTGTCTTTGXTCCTGCAACGGAAAGACCATCCAAAATTCAAGCGCTAGCATGCATGACCTGTTCCTATGAGCCCCTTCTCT
CCCTGACTGAGGCTCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan