ESTScan Details for Unigene SGN-U305269

Score 
407
Direction 
Forward
Predicted Peptide Sequence 
ATMSYDKELAAARKLXALAARLCHSGQNALLHADVHATSDPTPITLSDYSSQDEGIFVLHKXAASNTFSLVPDDDFEIFEKKWPIYTASN
KKLVYESLASGGTSSPLSDQEVLAAINSRKSDRGSLGRHWVLDPMDGTKGFLTGDQYAIALGLLDEGKVVLGVLACPNLPLQSLACHDQH
TIQGKAGCLFFAQVGTGTYMQSLDGSEPRKVHVSSTENPEEASFFESYEAASFNADLT
Predicted Coding Sequence 
XCTGCAACAATGTCTTATGATAAAGAACTTGCTGCTGCTAGAAAGCTTGXTGCACTTGCTGCTCGCCTCTGCCATTCAGGGCAAAATGCA
TTATTGCATGCTGATGTCCATGCTACATCTGATCCAACCCCTATAACATTATCTGATTATAGCTCACAGGATGAGGGAATCTTTGTGTTG
CATAAAXTAGCTGCTTCTAATACGTTCTCATTAGTACCTGACGACGATTTTGAGATCTTCGAAAAGAAATGGCCAATATACACTGCTTCA
AATAAGAAACTTGTCTATGAATCTCTTGCTAGTGGGGGAACATCATCTCCTTTATCTGATCAAGAGGTACTTGCTGCCATAAACTCAAGA
AAATCTGATAGAGGTTCTCTTGGTCGCCACTGGGTTTTGGATCCTATGGACGGTACTAAGGGGTTCCTAACGGGAGACCAGTATGCTATT
GCATTAGGATTGCTAGATGAAGGGAAAGTTGTATTGGGTGTTCTAGCTTGTCCAAATCTTCCTTTACAATCTCTTGCCTGCCATGATCAG
CACACCATCCAAGGCAAAGCTGGTTGTCTTTTCTTTGCCCAAGTTGGTACAGGAACCTACATGCAGTCTCTTGATGGCTCAGAACCTAGA
AAGGTGCATGTCAGTTCTACTGAAAATCCTGAAGAAGCATCATTCTTTGAATCTTATGAAGCAGCTTCATTCAATGCTGACTTAACX
Edits in Original Sequence 
(5')XCTGCAACAATGTCTTATGATAAAGAACTTGCTGCTGcCTAGAAAGCTTGXTGCACTTGCTGCTCGCCTCTGCCATTCAGGGCAAA
ATGCATTATTGCATGCTGATGTCCATGCTACATCTGATCCAACtCCCTATAACATTATCTGATTATAGCTCACAGGATGAGGGAATCTTT
GTGTTGCATAAAXTAGCTGtCTTCTAATACGTTCTCATTAGTACCTGACGACGATTaTTGAGATCTTCGAAAAGAAtATGGCCAATATAC
ACTGCTTCAAATAAcGAAACTTGTCTATGAATCTCTTGCaTAGTGGGGGAACATCATCTCCTTTATCTGATCAAGAGGTACTTGCTGCCA
TAAACTCAAGAAAATCTGATAGAGGTTCTCTTGGTCGCCACTGGGTTTTGGATCCTATGGACGGTACTAAGGGGTTCCTAACGGGAGACC
AGTATGCTATTGCATTAGGATTGCTAGATGAAGGGAAAGTTGTATTGGGTGTTCTAGCTTGTCCAAATCTTCCTTTACAATCTCTTGCCT
GCCATGATCAGCACACCATCCAAGGCAAAGCTGGTTGTCTTTTCTTTGCCCAAGTTGGTACAGGAACCTACATGCAGTCTCTTGATGGCT
CAGAACCTAGAAAGGTGCATGTCAGTTCTACTGAAAATCCTGAAGAAGCATCATTCTTTGAATCTTATGAAGCAGCTTCATTCAATGCaT
GACTTAACX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan