ESTScan Details for Unigene SGN-U305317

Score 
374
Direction 
Forward
Predicted Peptide Sequence 
LCSARGAPNVTQRLLACAAARFYIPPPAFDLLSPVSRYNGIDIAIRLLEPIKEQFPTLSYADFYQLAGVVAVEVTGGPDIPFHPGRQDKT
EPPVEGRLPDATKGCDHLRDVFVKQMGLSDQDIVALSGGHTLGRCHKERSGFDGPWTANPLIFDNSYFTELLSGDKEGLLQLP
Predicted Coding Sequence 
CTCTGCTCTGCTCGTGGCGCTCCTAACGTGACTCAGCGACTCTTGGCTTGTGCAGCTGCTAGGTTTTACATTCCTCCXCCTGCCTTCGAT
CTCCTCTCTCCGGTCTCGAGATACAATGGTATTGACATCGCTATTAGACTCTTGGAGCCCATCAAAGAGCAATTCCCTACTCTTTCTTAT
GCTGACTTTTATCAGCTAGCTGGTGTCGTCGCTGTTGAAGTTACTGGAGGACCTGATATTCCATTCCACCCAGGAAGACAGGATAAGACA
GAGCCACCAGTCGAAGGTCGTCTCCCTGATGCTACTAAGGGTTGCGACCATTTGAGGGATGTTTTCGTGAAACAAATGGGTCTCTCTGAC
CAGGATATTGTTGCTCTCTCTGGTGGCCACACCTTGGGAAGATGCCACAAGGAGCGCTCTGGATTTGATGGCCCGTGGACAGCTAACCCC
CTTATCTTTGACAACTCCTACTTTACGGAGCTTCTGAGTGGGGATAAAGAAGGACTTCTGCAGCTGCCT
Edits in Original Sequence 
(5')CTCTGCTCTGCTCGTGGCGCTCCTAACGTGACTCAGCGACTCTTGcGCTTGTGCAGCTGCTAGGTTTTACATTCCTCCXCCTGCCT
TCGATCTCCTCTCTCCGGTCTCGAGATACAATGGTATTGACATCGCTATTAGACTCTTGGAGCCCATCAAAGAGCAATTCCCTACTCTTT
CTTATGCTGACTTTTATCAGCTAGCTGGTGTCGTCGCTGTTGAAGTTACTGGAGGACCTGATATTCCATTCCACCCAGGAAGACAGGATA
AGACAGAGCCACCAGTCGAAGGTCGTCTCCCTGATGCTACTAAGGGTTGCGACCATTTGAGGGATGTTTTCGTGAAACAAATGGGTCTCT
CTGACCAGGATATTGTTGCTCTCTCTGGTGGCCACACCTTGGGAAGATGCCACAAGGAGCGCTCTGGATTTGATGGCCCGTGGACAGCTA
ACCCCCTTATCTTTGACAACTCCTACTTTACGGAGCTTCTGAGTGGGGATAAAGAAGGACTTCTGCAGCTGCCT(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan