ESTScan Details for Unigene SGN-U305327

Score 
511
Direction 
Forward
Predicted Peptide Sequence 
MEGEKMDTEGKVETEKMNKAIAMAYDVQSKIVEDLFGDHLHLGFYDSSSVIPGSDVNSAQTRMIEAALRFASVSVNQPGIIYHEKYAEDP
SKKPINILDVGCGIGGSTRYLASKYGSQCKGITLSPVEAERARVLTAAQGLESQVSFEVADALNQPFADGSFDLIWCIEGA
Predicted Coding Sequence 
ATGGAGGGGGAGAAGATGGATACAGAGGGAAAGGTGGAGACAGAGAAGATGAACAAGGCAATTGCCATGGCATATGATGTCCAATCTAAA
ATAGTAGAGGATCTATTTGGGGATCACCTCCATTTGGGCTTCTATGACTCTAGCTCCGTTATCCCTGGTTCTGATGTCAATTCTGCTCAG
ACTCGCATGATCGAGGCGGCCCTCCGTTTTGCCTCTGTATCAGTCAACCAACCXGGCATTATTTATCATGAAAAATATGCAGAGGATCCA
TCTAAGAAACCAATAAACATACTTGATGTTGGATGTGGAATTGGTGGCAGCACCAGGTACCTAGCAAGTAAATATGGTTCTCAATGTAAA
GGCATCACCCTTAGCCCTGTTGAGGCTGAAAGAGCTCGTGTTCTAACTGCTGCCCAAGGATTAGAAAGCCAGGTTTCCTTTGAAGTGGCA
GATGCATTGAATCAGCCATTTGCAGATGGGTCATTCGATTTAATTTGGTGTATTGAAGGTGCA
Edits in Original Sequence 
GCCCGAACCCTATAATCTCCCCCGCAGAAATACTCTTTAACATTCCATCCCTTAAACTCTTCCAAAAGTATTCCCAGAGTAACACTTGCT
GTCTAGCAGAAAAGAATTAGTCCCTGCATATTATGTGACCCTGAAAAAAAAAGAAAAAAACCATCTTTCTTTCTGTCCTTCATTAGTTTG
GCTCTAAAACTTAAGTAAGGTTAAGAGGATTGT
(5')ATGGAGGGGGAGAAGATGGATACAGAGGGAAAGGTGGAGACAGAGAAGATGAA
CAAGGCAATTGCCATGGCATATGATGTCCAATCTAAAATAGTAGAGGATCTATTTGGGGATCACCTCCATTTGGGCTTCTATGACTCTAG
CTCCGTTATCCCTGGTTCTGATGTCAATTCTGCTCAGACTCGCATGATCGAGGCGGCCCTCCGTTTTGCCTCTGTATCAGTCAACCAACC
XGGCATTATTTATCATGAAAtAATATGCAGAGGATCCATCTAAGAAACCAATAAACATACTTGATGTTGGATGTGGAATTGGTGGCAGCA
CCAGGTACCTAGCAAGTAAATATGGTTCTCAATGTAAAGGCATCACCCTTAGCCCTGTTGAGGCTGAAAGAGCTCGTGTTCTAACTGCTG
CCCAAGGATTAGAAAGCCAGGTTTCCTTTGAAGTGGCAGATGCATTGAATCAGCCATTTGCAGATGGGTCATTCGATTTAATTTGGTGTA
TTGAAGGTGCA(3')TGGTGTATTGAAGGTGCAGATCACATAAGCGACAAAACAAAGTTTGTTCATGAGTTGAATCGGGTGGCTGCCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan