ESTScan Details for Unigene SGN-U305400

Score 
486
Direction 
Forward
Predicted Peptide Sequence 
ETQEAPAQPLPHQRIIALEKSVKIGRPGYRVTNPFDPETKLRSLLFQIEYPEIEYYTQPMHRFMSSFELNIPPFDQRYQFLLFAAEPYEI
VAFKVPSXGPWINHLPSSSHTGINDSKMFTLQLYFKSKPPEANKPQSASAANGTAAPAAPPRPAPPPPQAPPPPPPPQGLPPAAPSXEYS
KSPPSISGSVPPRPPIANGSMLPGGTLPX
Predicted Coding Sequence 
XGCGAAACCCAGGAGGCTCCTGCTCAACCCCTTCCTCACCAGCGCATAATTGCGCTTGAAAAATCCGTTAAAATTGGCAGGCCTGGATAT
CGAGTGACAAATCCTTTTGATCCAGAGACTAAACTGAGGTCACTTCTCTTCCAGATAGAATATCCTGAGATTGAATACTACACCCAGCCC
ATGCACCGCTTTATGTCATCCTTTGAGCTGAACATCCCACCTTTTGACCAGAGATATCAGTTTCTTCTATTTGCGGCTGAGCCTTATGAA
ATCGTTGCTTTCAAGGTTCCTAGCXGCGGACCATGGATAAATCACCTCCCAAGTTCTTCTCACACTGGGATCAATGACTCTAAAATGTTT
ACGCTCCAGCTATATTTCAAGTCAAAGCCTCCTGAAGCAAATAAACCTCAATCTGCTTCTGCAGCCAATGGGACAGCGGCTCCTGCTGCT
CCACCTAGGCCTGCGCCGCCTCCACCTCAAGCTCCACCACCACCTCCACCACCTCAGGGACTCCCTCCGGCAGCTCCATCAGXGGAATAT
TCCAAGAGTCCCCCTTCTATATCTGGTTCCGTTCCCCCTCGGCCACCTATAGCAAATGGTTCTATGCTTCCTGGTGGAACTTTGCCTGXX
Edits in Original Sequence 
(5')XGCGAAACCCAGGAGGCTCCTGCTCAACCCCTTCCTCACCAGCGCATAATTGCGCTTGAAAAATCCGTTAAAATTGGCAGGCCTGG
ATATCGAGTGACAAATCCTTTTGATCCAGAGACTAAACTGAGGTCACTTCTCTTCCAGATAGAATATCCTGAGATTGAATACTACACCCA
GCCCATGCACCGCTTTATGTCATCCTTTGAGCTGAACATCCaCACCTTTTGACCAGAGATATCAGTTTCTTCTATTTGCGGCTGAGCCTT
ATGAAATCGTTGCTTTCAAGGTTCCTAGCXGCGGACCATGGATAAATCACCTCCCAAGTTCTTCTCACACTGGGATCAATGACTCTAAAA
TGTTTACGCTCCAGCTATATTTCAAGTCAAAGCCTCCTGAAGCAAATAAACCTCAATCTGCTTCTGCAGCCAATGGGACAGCGGCTCCTG
CTGCTCCACCTAGGCCTGCGCCGCCTCCACCTCAAGCTCCACCACCACCTCCACCACCTCAGGGACTCCCTCCGGCAGCTCCATCAGXGG
AATATTCCAAGAGTCCCCCTTCTATATCTGGTTCCGTTCCCCCTCGGCCACCTATAGCAAATGGTTCTATGCTTCCTGGTGGAACTTTGC
CTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan