ESTScan Details for Unigene SGN-U306024

Score 
320
Direction 
Forward
Predicted Peptide Sequence 
LTLTPPLSLQFNCLSPSSQRSLSIDPVSSFPPKNLTISERNSSVLRAQNIDYKSEKQRSLESMDSKKDSTELNRELYLDIEPYSTGFLKV
SDLHTIYWEQSGNPNGHPVVFLHGGPGGGTSPNNRKFFDSAFYRIILFDQRGAGKSTPHACLVENTTWDLVNDIEKLREHLQIPEWQVFG
GSWGSTLALAYSQSHPEKVTGLVLRGIFLLRKKEIDWFYEGGAAAX
Predicted Coding Sequence 
XXTCTCACTCTCACTCCTCCACTCTCTCTCCAATTCAATTGCTTAAGCCCTTCTTCCCAGCGCTCTCTTTCCATCGACCCXGTTTCCTCT
TTTCCTCCCAAAAATCTCACGATCTCAGAACGGAATAGTAGTGTGTTGAGGGCACAAAATATTGATTATAAGAGTGAGAAGCAGCGGAGT
TTGGAATCTATGGATTCTAAGAAAGACTCTACGGAATTAAATAGAGAGCTCTACCTAGATATAGAGCCATATAGTACTGGTTTCCTGAAG
GTTTCAGATCTTCATACTATATACTGGGAGCAGTCAGGGAATCCCAACGGGCATCCAGTTGTTTTTCTCCATGGAGGCCCAGGAGGTGGA
ACTTCACCAAATAATCGAAAATTTTTTGACTCTGCATTTTATCGGATTATTCTATTTGATCAGCGAGGTGCAGGAAAAAGCACACCCCAT
GCTTGTTTAGTAGAGAATACCACCTGGGACCTGGTGAATGACATTGAAAAGCTCAGAGAGCACTTACAAATTCCAGAATGGCAGGTATTT
GGGGGTTCATGGGGGAGTACGCTTGCTCTTGCATATAGCCAGTCACACCCTGAAAAGGTCACTGGCTTGGTCCTGCGGGGGATATTTTTG
TTGCGCAAGAAAGAAATTGATTGGTTCTACGAGGGTGGTGCTGCTGCTATX
Edits in Original Sequence 
(5')XXTCTCACTCTCACTCCTCCACTCTCTCTCCAATTCAATTGCTTAAGCCCTTCTTCCCAGCGCTCTCTTTCCATCGACCCXGTTTC
CTCTTTTCCTCCCAAAAATCTCACGATCTCAGAACGGAATAGTAGTGTGTTGAGGGCACAAAATATTGATTATAAGAGTGAGAAGCAGCG
GAGTTTGGAATCTATGGATTCTAAGAAAGACTCTACGGAATTAAATAGAGAGCTCTACCTAGATATAGAGCCATATAGTACTGGTTTCCT
GAAGGTTTCAGATCTTCATACTATATACTGGGAGCAGTCAGGGAATCCCAACGGGCATCCAGTTGTTTTTCTCCATGGAGGCCCAGGAGG
TGGAACTTCACCAAATAATCGAAAATTTTTTGACTCTGCATTTTATCGGATTATTCTATTTGATCAGCGAGGTGCAGGAAAAAGCACACC
CCATGCTTGTTTAGTAGAGAATACCACCTGGGACCTGGTGAATGACATTGAAAAGCTCAGAGAGCACTTACAAATTCCAGAATGGCAGGT
ATTTGGGGGTTCATGGGGGAGTACGCTTGCTCTTGCATATAGCCAGTCACACCCTGAAAAGGTCACTGGCTTGGTCCTGCGGGGGATATT
TTTGTTGCGCAAGAAAGAAATTGATTGGTTCTACGAGGGTGGTGCTGCTGCTATX(3')TATCCCCTGATGCTGGGAATCTTCAGAGATC
TTATCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan