ESTScan Details for Unigene SGN-U306445

Score 
272
Direction 
Forward
Predicted Peptide Sequence 
LAMTAAHIKPXLRMPLSRLESNAAASASLPDSLFHPLLLSTSSPPAXLNPPGFGNQSYRGRRRFYLSSCVDGVGAVQLQTSASTVAAAPV
QQNVVLEIPQDSSKDTVEQLLSESKXPPTPRRFQTHENGTEARGYPKLLLQGGTDRWFPYLDNFKADNGVCLSSAQVLEALDPYIMVSRK
ERFRNVVNNRSYSVCLVVEGLADFGNVSAAFRSADALAFSPFTSSPVTVQKGATRPEVPRQSSVSMGAEKWLDIELWX
Predicted Coding Sequence 
XGTTTGGCAATGACAGCTGCACATATTAAGCCGGXGCTCCGCATGCCACTCTCTCGTCTGGAATCCAATGCAGCAGCTTCTGCTTCTCTT
CCAGACTCTCTCTTCCATCCTCTTCTCCTCTCCACTTCTTCTCCTCCTGCTXCCCTCAACCCACCAGGGTTTGGAAACCAGTCTTACCGG
GGCAGGAGGCGTTTCTATTTGAGCAGCTGTGTTGATGGAGTAGGAGCTGTTCAGCTCCAAACTTCTGCTTCTACGGTTGCCGCCGCACCT
GTTCAACAAAATGTCGTCTTGGAAATTCCCCAGGATTCGTCCAAAGACACCGTCGAACAGTTGCTCTCCGAATCCAAGAXGCCACCAACA
CCACGACGTTTCCAGACTCATGAAAATGGAACGGAGGCTCGAGGCTACCCAAAGCTCCTTCTGCAAGGCGGGACAGACCGATGGTTCCCC
TATTTAGATAACTTCAAGGCCGACAATGGTGTGTGTTTGAGCAGCGCTCAAGTGTTGGAGGCGTTGGATCCGTATATCATGGTGTCCAGG
AAAGAGAGGTTTCGAAACGTGGTTAACAATCGGAGTTATTCTGTGTGTTTGGTGGTTGAAGGACTTGCCGATTTTGGTAATGTTTCTGCA
GCGTTTAGGTCTGCTGATGCATTGGCTTTCAGTCCGTTCACGTCGTCTCCTGTGACGGTTCAAAAAGGTGCAACAAGGCCTGAGGTACCG
AGACAATCGTCCGTCAGCATGGGAGCTGAGAAGTGGTTGGATATTGAACTCTGGGAX
Edits in Original Sequence 
(5')XGTTTGGCAATGACAGcCTGCACATATTAAGCCGGXGCTCCGCATGCCACTCTCTCGTCTGGAATCCAATGCaAGCAGCTTCTGCT
TCTCTTCCAGACTCTCTCTTCCATCCTCTTCTCCTCTCCACTTCTTCTCCTCCTGCTXCCCTCAACCCACCAGGGTTTGGAAACCAGTCT
TACCGGGGCAGGAGGCGTTTCTATTTGAGCAGCTGTGTTGATGGAGTAGGAGCTGTTCAGCTCCAAACTTCTGCTTCTACGGTTGCCGCC
GCACCTGTTCAACAAAATGTCGTCTTGGAAATTCCCCAGGATTCGTCCAAAGACACCGTCGAACAGTTGCTCTCCGAATCCAAGAXGCCA
CCAACACCACGACGTTTCCAGACTCATGAAAATGGAACGGAGGCTCGAGGCTACCCAAAGCTCCTTCTGCgAAGGCGGGACAGACCGATG
GTTCCCCTATTTAGATAACTTCAAGGCCGACAATGGTGTGTGTTTGAGCAGCGCTCAAGTGTTGGAGGCGTTGGATCCGTATATCATGGT
GTCCAGGAAAGAGAGGTTTCGAAACGTGGTTAACAATCGGAGTTATTCTGTGTGTTTGGTGGTTGAAGGACTTGCCGATTTTGGTAATGT
TTCTGCAGCGTTTAGGTCTGCTGATGCATTaGGCTTTCAGTCCGTTCACGTCGTCTCCTGTGACGGTTCAAAAAGGTGCAACAAGGCCTG
AGGTACCGAGACAATCGTCaCGTCAGCATGGGAGCTGAGAAGTGGTTGGATATTGAACTCTGGGAX(3')TTCCACCAGGAGTGCTTTAA
AGTTTTGAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan