ESTScan Details for Unigene SGN-U306692

Score 
535
Direction 
Forward
Predicted Peptide Sequence 
PEEVLDLIEGSELWLEKAILYRKLGQETLXAPNIGLEAGGLEAAEQYCAEIGRPDAYMQLLEMYLDPKDGKEPMFKAAVRLLHNHGEALD
PLQVLERLSPDMPLQLASDTILRMLRARLHHHRQGQIVHNLSRALDVDASLARLEERSRHVLINDESVCDSCHARLGTKLFAMYPDDTIA
AISVFVVKVNPPLSQXRNFEEDVLYKPGWLEHGDHGKADDLLCLELAAWHDQELRLHMQLX
Predicted Coding Sequence 
XXCCCAGAAGAGGTCCTTGACTTGATTGAAGGATCCGAATTGTGGCTGGAAAAGGCTATTCTTTACAGGAAGCTTGGTCAAGAAACATTA
GXTGCTCCAAATATTGGCCTTGAAGCTGGAGGACTTGAAGCTGCCGAACAATATTGTGCAGAAATTGGTAGACCAGATGCCTACATGCAA
CTGCTTGAGATGTATTTGGATCCGAAGGATGGCAAAGAGCCCATGTTTAAGGCTGCTGTCCGCCTTCTCCACAATCATGGAGAAGCACTT
GACCCTTTACAAGTCTTGGAGAGGTTGTCCCCTGACATGCCCCTCCAGCTTGCTTCAGATACTATATTGAGAATGCTGAGGGCACGGCTT
CATCATCATCGGCAAGGGCAAATTGTCCATAATCTATCCCGTGCTTTAGATGTCGATGCGAGCTTGGCACGATTGGAGGAAAGGTCACGC
CACGTGCTGATCAATGATGAGAGTGTTTGTGATTCTTGTCATGCTCGGCTTGGAACCAAATTATTTGCAATGTACCCAGATGACACAATT
GCTGCTATAAGTGTTTTCGTCGTCAAGGTGAATCCACCTCTGTCACAGGXTCGTAATTTCGAGGAAGATGTTTTATATAAACCAGGCTGG
TTGGAACACGGTGACCATGGAAAAGCAGATGATCTTCTATGTCTTGAGCTGGCTGCATGGCATGATCAAGAACTCCGGTTGCATATGCAA
TTGCXX
Edits in Original Sequence 
(5')XXCCCAGAAGAGGTCCTTGACTTGATTGAAGGATCCGAATTGTGGCTGGAAAAGGCTATTCTTTACAGGAAGCTTGGTCAAGAAAC
ATTAGXTGCTCCAAATATTGGCCTTGAAGCTGGAGGACTgTGAAGCTGCCGAACAATATTGTGCAGAAATTGGTAGACCAGATGCCTACA
TGCAACTGCTTGAGATGTATTTGGATCCGAAGGATGGCAAAGAGCCCATGTTTAAGGCTGCTGTCCGCCTTCTCCACAATCATGGAGAAG
CACTTGACCCTTTACAAGTCTTGGAGAGGTTGTCCCCTGACATGCCCCTCCAGCTTGCTTCAGATACTATATTGAGAATGCTGAGGGCAC
GGCTTCATCATCATCGGCAAGGGCAAATTGTCCATAATCTATCCCGTGCTTTAGATGTCGATGCGAGCTTGGCACGATTGGAGGAAAGGT
CACGCCACGTGCTGATCAATGATGAGAGTGTTTGTGATTCTTGTCATGCTCGGCTTGGAACCAAATTATTTGCAATGTACCCAGATGACA
CAATTGtCTGCTATAAGTGTTTTCGTCGTCAAGGTGAATCCACCTCTGTCACAGGXTCGTAATTTCGAGGAAGATGTTTTATATAAACCA
GGCTGGTTGGtAACACGGTGACCATGGAAAAGCAGATGATCTTCTATGTCTTGAGCTGGCTGCATGGCATGATCAAGAACTCCGGTTGCA
TATGCAATTGCXX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan