ESTScan Details for Unigene SGN-U306788

Score 
221
Direction 
Forward
Predicted Peptide Sequence 
GTCPIVSGVKXVQLEPDXDFDVLHTNLIIAGGIDGSGFLSHAINLYLRYKPPIEELYQFLEFQLPRQWAPVFGELPLGPDRKQQSGASLQ
FSLMGPKLYVNTNPVDVGNKPXDRTSTVFRREKKRLPSNSFAAPSSLPKSFQLQNNSNHNAGNSYDHRYYEKVX
Predicted Coding Sequence 
XCAGGAACTTGTCCCATAGTAAGTGGTGTCAAAGXTGTCCAGCTTGAACCTGATGXTGATTTTGATGTCCTTCATACCAATCTCATCATT
GCTGGTGGAATTGATGGAAGTGGATTTTTGAGCCATGCTATCAACCTTTACCTACGATATAAACCACCAATTGAAGAACTATATCAGTTT
TTGGAGTTTCAACTTCCTCGGCAATGGGCGCCAGTATTTGGTGAACTTCCCCTAGGTCCTGACAGAAAGCAGCAGAGTGGTGCATCTTTG
CAGTTCAGCTTAATGGGTCCAAAGCTATATGTTAATACAAACCCGGTTGATGTGGGCAATAAGCCTGXTGACCGGACTTCGACTGTATTT
AGAAGGGAAAAGAAGCGATTGCCTAGCAATTCATTTGCAGCACCTTCCTCTTTACCCAAGAGCTTTCAGCTTCAGAATAATTCAAATCAC
AATGCAGGTAACTCGTATGACCACAGGTATTATGAGAAAGTCCAX
Edits in Original Sequence 
(5')XCAGGAACTTGTCCCATAGTAAGTGGTGTCAAAGXTGTCCAGCTTGAACCTGATGXTGATTTTGATGTCCTTCATACCAATCTCAT
CATTGCTGaGTGGAATTGATGGAAGTGGATTTTTGAGCCATGCTATCAACCTTTACCTACGATATAAACCACCAATTGAAGAACTATATC
AGTTTTTGGAGTTTCAACTTCCTCGGCAATGGGCGCCAGTATTTGGTGAACTTCCCCTAGGTCCTGACAGAAAGCAGCAGAGTGGTGCAT
CTTTGCAGTTCAGCTTAATGGGTCCAAAGCTATATGTTAATACAAACCCGGTTGATGTGGGCAATAAGCCTGXTGACCGGACTTCGACTG
TATTTAGAAGGGAAAAGAAGCGATTGCCTAGCAATTCATTTGCAGCACCtTTCCTCTTTACCCAAGAGCTTTCAGCTTCAGAATAATTCA
AATCACAATGCAGGTAACTCGTATGACCACAGGTATTATGAGAAAGTCCAX(3')A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan