ESTScan Details for Unigene SGN-U306880

Score 
488
Direction 
Forward
Predicted Peptide Sequence 
HQGDEKSLDFLNSPNLKILNKSVLQLAFSEGDEEGFLREVLEKFKEPDKTTVCVLDNFDGNSMKVAELLAKNGLKEAYAIRGGIRGNIXM
AGDTGNSAPSICAHHPKKKAKVSQQPSGNGGANSQTEGSSSSVTGLLANEPEKISNESVISSSELTSGTKCGPRSSSPYPNYPDLKPPSS
PTPSKPKYDAQPPDLDAETSHCLGSFSERLLHLWHSIISEERAEFSLIHRGEPTSGFFHX
Predicted Coding Sequence 
XXGCACCAGGGGGATGAGAAGAGTTTGGATTTCCTGAATTCACCTAATTTGAAGATTTTAAATAAGAGTGTGCTGCAGTTGGCGTTTTCC
GAAGGAGATGAAGAAGGTTTTTTGAGGGAAGTTTTGGAAAAATTTAAGGAGCCAGATAAAACCACTGTTTGTGTTCTGGACAATTTTGAC
GGTAACTCCATGAAAGTGGCTGAGTTATTAGCCAAAAATGGACTTAAGGAAGCTTATGCAATTAGAGGTGGAATTAGAGGCAACATTXTG
ATGGCAGGAGATACAGGAAACTCTGCTCCCTCCATCTGTGCACATCACCCCAAGAAGAAGGCCAAAGTTTCACAGCAACCTAGTGGTAAT
GGTGGAGCAAACAGCCAAACTGAAGGTAGCTCATCATCTGTTACCGGTCTGCTTGCCAACGAACCTGAAAAGATCAGCAATGAGTCTGTA
ATCAGTTCTTCTGAACTGACCTCTGGGACAAAATGTGGCCCTAGATCATCATCTCCATACCCAAATTATCCAGATTTGAAACCACCATCA
TCCCCNACACCATCAAAGCCAAAATATGATGCACAGCCTCCTGACTTAGATGCTGAAACTTCTCATTGCTTGGGTAGTTTTTCTGAGCGG
TTGCTTCACTTGTGGCATTCCATAATTTCTGAGGAGAGGGCAGAGTTTAGTTTGATCCATAGAGGGGAGCCTACTTCTGGATTTTTTCAT
TXX
Edits in Original Sequence 
(5')XXGCACCAGGGGGATGAGAAGAGTTTGGATTTCCTGAATTCACCTAATTTGAAGATTTTAAATAAGAGTGTGCTGCAGTTGGCGTT
TTCCGAAGGAGATGAAGAAGGTTTTTTGAGGGAAGTTTTGGAAAAATTTAAGGAGCCAGATAAAACCACTGTTTGTGTTCTGGACAATTT
TGACGGTAACTCCATGAAAGTGGCTGAGTTATTAGCCAAAAATGGACTTAAGGAAGCTTATGCAATTAGAGGTGGAATTAGAGGCAACAT
TXTGATGGCAGGAGATACAGGAAACTCTGCTCCCTCCATCTGTGCACATCtACCCCAAGAAGAAGGCCAAAGTTTCACAGCAACCTAGTG
GTAATGGTGGAGCAAACAGCCAAACTGAAGGTAGCTCATCATCTGTTACCGGTCTGCTTGCCAACGAACCTGAAAAGATCAGCAATGAGT
CTGTAATCAGTTCTTCTGAACTGACCTCTGGGACAAAATGTGGCCCTAGATCATCATCTCCATACCCAAATTATCCAGATTTGAAACCAC
CATCATCCCCNACACCATCAAAGCCAgAAATATGATGCACAGCCTCaCTGACTTAGATGCTGAAACTTCgTCATTGCTTGGGTAGTTTTT
CTGAGCGGTTGCTTCgACTTGTGGCATTCCATAATTTCTGAGGAGAGGGCAGAGTTTAGTTTGATCCATAGAGGGGAGCCTACTTCTGGA
TTTTTTCATTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan