ESTScan Details for Unigene SGN-U306962

Score 
636
Direction 
Forward
Predicted Peptide Sequence 
MAYELKLNFEVLKQMKLARAVFLEHLLLNELEKITDAASAEEYAAFEERVRRTVYMDNLSPQVTENVLKAALHQFVNVINVQFIPNYINP
QSLPRAALAEMETLKQASAIIAEVADSPFMVLGMPRPVRARAAEVEMFEVAXKKPGRKITYKWLDPEDPDFEVAXEELGFDRKAASETRI
PAHHPLKGGGNLANQQLETLKRTI
Predicted Coding Sequence 
ATGGCTTATGAGCTCAAGCTGAACTTTGAAGTGCTCAAACAAATGAAGTTGGCTCGAGCTGTTTTCCTTGAACATTTGCTGCTGAATGAG
CTGGAGAAGATTACTGATGCAGCTTCAGCTGAAGAATATGCGGCATTTGAAGAAAGGGTGAGAAGAACAGTCTATATGGATAACCTGTCA
CCTCAGGTGACAGAGAATGTTCTGAAAGCCGCTTTGCATCAATTTGTCAATGTCATAAATGTCCAATTCATTCCCAACTATATCAATCCA
CAGAGCCTCCCACGAGCTGCTTTGGCGGAGATGGAAACTCTGAAGCAGGCCTCTGCGATCATTGCTGAGGTGGCTGATTCTCCCTTTATG
GTCCTTGGGATGCCAAGACCTGTCAGAGCACGTGCTGCAGAAGTAGAAATGTTTGAAGTCGCCXCAAAGAAACCTGGCAGGAAGATCACT
TACAAGTGGCTGGACCCTGAAGATCCTGATTTTGAGGTTGCCAXGGAAGAATTAGGTTTTGACCGGAAAGCTGCTTCTGAAACXCGAATT
CCTGCTCATCATCCACTCAAAGGAGGAGGAAACCTTGCAAACCAGCAGCTGGAGACCTTGAAGCGCACTATA
Edits in Original Sequence 
GTCGAACCCTGCGGCCACCTTCCGTCTCCTCATTCCAACACAATCCTCCCCTTCGCTGCTCGTTTAAAGGCTTTTTGAAATAGCAGTGTA
ATAAAGCAAAGTCGAGTCAAGTT
(5')ATGGCTTATGAGCTCAAGCTGAACTTTGAAGTGCTCAAACAAATGAAGTTGaGCTCGAGCTGT
TTTCCTTGAACATTTGCTGCTGAATGAGCTGGAGAAGATTACTGATgGCAGCTTCAGCTGAAGAATATGCGGCATTTGAAGAAAGGGTGA
GAAGAACAGTCTATATGGATAACCTGTCACCTCAGGTGACAGAGAATGTTCTGAAAGCCGCTTTGCATCAATTTGTCAATGTCATAAATG
TCCAATTCATTCCCAACTATATCAATCCACAGAGCCTCCCACGAGCTGCTTTGGCGGAGATGGAAACTCTGAAGCAGGCCTCTGCGATCA
TTGCTGAGGTGGCTGATTCTCCCTTTATGGTCCTTGGGATGCCAAGACCTGTCAGAGCACGTGCTGCAGAAGTAGAAATGTTTGAcAGTC
GCCXCAAAGAAACCTGGCAGGAAGATCACTTACAAGTGGCTGGACCCTGAAGATCCTGATTTTGAGGTTGCCAXGGAAGAATTAGGTTTT
GACCGGAAAGCaTGCTTCTGAAACXCGAATTCCTGCTCATCATCCACTCAAAGGAGGAGGAAACCTTGCAAACCAGCAGCTGGAGACCTT
GAAGCGCACTATA(3')AAGAAATATGAGTTGATAGATGGTGTCCTATCTGACAATACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan