Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

Due to a hardware issue, SGN was briefly unavailable earlier today. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U307090

Score 
322
Direction 
Forward
Predicted Peptide Sequence 
SSPPSRRVEWGXGVAEQSSQLSKDLGGPYGRMYKYSYYSLSIEDTTIRMEFYAEEGKKLDEACSSLVLPALSIGNVGQLAVDLFISSLRA
ERIGYFDDPNVLPCVGNNAYAPSPPGDLSLPLEAFDSSSNRLTLVQQRSPVVKGMMVEFAKNLANFAATNGKKHVIILSSLDFKQWQNIE
MSSGLQIYYLSSSSTDGTDEDCEKHGWKRLPEYNPAHRRWEYLSSANEENIVQDDDLLX
Predicted Coding Sequence 
XGTTCTTCTCCTCCTTCAAGAAGAGTGGAGTGGGGTGXTGGGGTAGCAGAGCAGAGCTCACAGCTCTCGAAAGACCTCGGTGGTCCATAT
GGTCGTATGTATAAGTATTCGTACTACTCTTTGAGCATTGAAGATACTACAATACGGATGGAATTTTATGCTGAGGAAGGAAAAAAACTA
GACGAAGCATGTTCTTCTCTTGTATTGCCGGCGCTGTCCATCGGGAACGTCGGACAGTTGGCGGTGGACCTATTCATATCGTCATTGAGA
GCTGAGAGAATCGGTTACTTTGACGATCCTAACGTTCTGCCCTGCGTCGGCAACAACGCTTATGCGCCTTCTCCTCCCGGCGATCTCTCC
CTCCCTCTCGAAGCTTTTGATTCGTCCTCCAACCGATTGACTCTTGTACAGCAGAGGTCTCCAGTTGTAAAGGGTATGATGGTTGAATTT
GCTAAGAATCTGGCAAATTTTGCAGCCACAAATGGAAAGAAGCATGTCATTATCCTCTCCAGCTTGGATTTTAAGCAGTGGCAAAACATC
GAAATGTCAAGTGGTTTGCAGATATATTACCTGTCTAGTTCCAGCACAGATGGGACAGATGAGGACTGTGAAAAACATGGATGGAAGAGA
CTACCGGAATATAATCCTGCTCACAGGAGGTGGGAGTATCTTAGTTCCGCTAATGAAGAAAATATTGTTCAAGATGATGATTTGCTTTXX
Edits in Original Sequence 
(5')XGTTCTTCTCCTCCTTCAAGAAGAGTGGAGTGGGGTGXTGGGGTAGCAGAGCAGAGCTCACAGCTCTCGAAAGACCTCGGTGGTcC
CATATGGTCGTATGTATAAGTATTCGTACTACTCTTTGAGCATTGAAGATACTACAATaACGGATGGAATTTTATGCTGAGGAAGGAAAA
AAACTAGACGAAGCATGTTCTTCTCTTGTATTGCCGGCGCTGTCCATCGGGAACGTCGGACAGTTGGCGGTGGACCTATTCATATCGTCA
TTGAGAGCTGAGAGAATCGGTTACTTTGACGATCCTAACGTTCTGCCCTGCGTCGGCAACAACGCTTATGCGCCTTCTCCTCCCGGCGAT
CTCTCCCTCCCTCTCGAAGCTTTTGATTCGTCCTCCAACCGATTGACTCTTGTACAGCAGAGGTCTCCAGTTGTAAAGGGTATGATGGTT
GAATTTGCTAAGAATCTGGCAAATTTTGCAGCCACAAATGGAAAGAAGCATGTCATTATCCTCTCCAGCTTGGATTTTAAGCAGTGGCAA
AACATCGAAATGTCAAGTGGTTTGCAGATATATTACCTGTCTAGTTCCAGCACAGATGGGACAGATGAGGACTGTGAAAAACATGGATGG
AAGAGACTACCGGAATATAATCCTGCTCACAGGAGGTGGGAGTATCTTAGTTCCGCTAATGAAGAAAATATTGTTCAAGATGATGATTTG
CTTTXX(3')TGAGGGATTAAAAGAGAGGATACTATCCAGTTTTGCTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan