ESTScan Details for Unigene SGN-U307212

Score 
857
Direction 
Forward
Predicted Peptide Sequence 
SIPFKAAAAGQPSGQVLYGTAGGMSPQVQARSQQIPGSTPDIKTEMNPILNHRAAGPEGSLIGIPGSNQGGNNLTLKGWPLTGLEQLRTG
LIQQQKSFMQGSXALSSTTDVNTTTSATAYAGTAKLNISAASDESRRLRMLLNNRNMTMSKDGLSNSVGDVVPNLGSPLQAGCPVMPRAD
PDMVLKLKLAQMQQQQQQQQQQQQNNNPQQQQLQQHALAGQQPQSSNHNVQANKIMGSNNVTGDGIMSKFLPANDRASKSQX
Predicted Coding Sequence 
XCTTCAATACCATTTAAAGCTGCAGCAGCCGGCCAGCCCTCAGGGCAAGTGCTTTATGGTACTGCTGGTGGCATGTCCCCACAAGTCCAG
GCTCGTAGCCAGCAAATTCCAGGGTCTACACCAGACATTAAGACAGAGATGAATCCGATACTGAATCATAGAGCTGCAGGTCCTGAAGGT
TCACTGATTGGGATTCCTGGATCAAATCAAGGTGGAAACAATTTGACATTGAAAGGATGGCCTCTTACTGGGTTGGAACAGCTTCGCACT
GGGCTCATCCAGCAGCAAAAATCATTTATGCAAGGTTCAXCAGCCCTTTCATCAACTACAGATGTTAACACCACAACATCAGCAACAGCT
TATGCTGGCACAGCAAAACTTAACATCTCCGCTGCTAGTGATGAAAGCAGAAGGCTTAGAATGCTACTTAATAATCGAAATATGACCATG
AGTAAGGATGGCCTTTCAAATTCAGTTGGTGATGTGGTCCCAAATCTTGGTTCACCCTTACAAGCTGGTTGCCCTGTTATGCCTCGTGCA
GATCCGGATATGGTGCTAAAGTTAAAATTGGCTCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGAATAATAATCCACAA
CAGCAGCAGTTACAACAGCATGCACTTGCTGGTCAGCAACCACAGAGTTCTAATCATAATGTTCAGGCAAATAAAATTATGGGAAGCAAT
AATGTCACTGGAGATGGCATCATGTCAAAATTCCTTCCTGCAAATGATCGGGCTTCAAAAAGTCAGAXX
Edits in Original Sequence 
(5')XCTTCAATACCATTTAAAGCTGCAGCAGCCGGCCAGCCCTCAGGGCAAGTGCTTTATGGTACTGCTGGTGGCATGTCCCCACAAGT
CCAGGCTCGTAGCCAGCAAATTCCAGGGTCTACACCAGACATTAAGACAGAGATGAATCCGATACTGAATCATAGAGCTGCAGGTCCTGA
AGGTTCACTGATTGGGATTCCTGGATCAAATCAAGGTGGAAACAATTTGACATTGAAAGGATGGCCTCTTACTGGGTTGGAACAGCTTCG
CACTGGGCTCATCCAGCAGCAAAAATCATTTATGCAAGGTTCAXCAGCCCTTTCATCAACTACAGATGTTAACACCACAACATCAGCAAC
AGCTTATGCTGGCACAGCAAAACTTAACATCTCCGtCTGCTAGTGATGAAAGCAGAAGGCTTAGAATGCTACTTAATAATCGAAATATGA
CCATGAGTAAGGATGGCCTTTCAAATTCAGTTGGTGATGTGGTCCCAAATCTTGGTTCACCCTTACAAGCTGGTTGCCCTGTTATGCCTC
GTGCAGATCCGGATATGGTGCTAAAGTTAAAATTGGCTCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGAATAATAATC
CACAACAGCAGCAGTTACAACAGCATGCACTTGCTGGTCAGCAACCACAGAGTTCTAATCATAATGTTCAGGCAAATAAAATTATGGGAA
GCAATAATGTCACTGGAGATGGCATCATGTCAAAATTCCTTCCgTGCAAATGATCGGGCTTCAAAAAGTCAGAXX(3')ACTGGAAAAAA
AGAAAAAACAGCCTGTGTCATCTTCGGGGCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan