ESTScan Details for Unigene SGN-U307226

Score 
-24
Direction 
Forward
Predicted Peptide Sequence 
MGLQNQLADISTESFPILMVALVANCVGYIRSILIGAFQAFGLSLAMFDVSNLYHVDDASCDAVGSGLTGIIMLAXAIKAEPGLFFRLAG
DGAAGMRVGFGFGLRGVPEPVGEGDHVRKLAAAMFSTRSASDGWLDHMNFNFLCAGCPWSPMSAGRHEAAVTGDVLEWFSLRECGHALQR
PGDDDLMIINEDYD
Predicted Coding Sequence 
ATGGGACTACAAAACCAGCTGGCAGACATCTCCACAGAGTCCTTCCCAATTTTAATGGTAGCCCTCGTCGCCAATTGTGTAGGCTACATC
CGTTCAATCCTCATCGGAGCTTTCCAAGCCTTTGGCCTTTCTCTAGCCATGTTCGACGTCTCCAATCTGTACCATGTCGACGACGCCTCT
TGCGACGCTGTCGGGTCCGGCCTAACCGGAATCATTATGCTCGCCGXAGCAATTAAAGCTGAACCGGGCCTTTTCTTCCGGCTTGCCGGT
GATGGTGCTGCXGGGATGCGGGTCGGGTTCGGGTTCGGATTGCGTGGTGTGCCTGAACCGGTTGGGGAAGGTGACCATGTGCGCAAGTTA
GCTGCCGCCATGTTTTCCACAAGGAGTGCTTCXGATGGTTGGCTTGATCATATGAACTTTAATTTCCTCTGTGCCGGATGCCCTTGGTCG
CCGATGAGTGCTGGCCGTCACGAAGCGGCGGTGACTGGTGATGTTCTTGAATGGTTCTCTTTGAGGGAGTGTGGGCACGCGCTGCAGCGT
CCTGGTGATGATGACTTGATGATAATTAATGAGGATTATGATTGA
Edits in Original Sequence 
ACATAGATAACACTACCAATAGGTTGGGTACTGCCTTTTTTAACCCATAAAAGATGGGACTACAAAACCA(5')ATGGGACTACAAAACC
AGCTGGCAGACATCTCCACAGAGTCCTTCCCAATTTTAATGGTAGCCCTCGTCGCCAATTGTGTAGGCTACATCCGTTCAATCCTCATCG
GAGCTTTCCAAGCCTTTGGCCTTTCTCTAGCCATGTTCGACGTCTCCAATCTGTACCATGTCGACGACGCCTCTTGCGACGCTGTCGGGT
CCGGCCTAACCGGAATCATTATGCTCGCCGXAGCAATTAAAGCTGAACCGGGCCTTTTCTTaCCGGCTTGCCGGTGATGGTGCTGCXGGG
ATGCGGGTCGGGTTCGGGTTCGGATTGCGTGGTGTGCCTGAACCGGTTGGGcGAAGGTGACCATGTGCGCAAGTTAGCgTGCCGCCATGT
TTTCCACAAGGAGTGCTTCXGATGGTTGGCTTGATCATATGAACTTTAATTgTCCTCTGTGCCGGATGCCCTTGGTCGCCGATGAGTGCg
TGGCCGTCACGAAGCGGCGcGTGACTGGTGATGTTCTTGAATGGTTCTCTTTGAGGtGAGTGTGGGCACGCGCTGCAGCGTCCgTGGTGA
TGATGACTTGATGATAATTAATGAGGATTATGATTGA(3')GGCTTCTTTTTTTATTCTTGGAGGTGTTTTTTTTTTTAGAGGGGGGAGG
GGTTTGAAGGGAGTGTAAATATGTTAAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan