ESTScan Details for Unigene SGN-U307240

Score 
303
Direction 
Forward
Predicted Peptide Sequence 
EGMXDLKKQPDHDTPEKDDEVXAGKRDDTALHSAARAGNLKAVWEIIHQSSEEELIELLSKQNSAGETALYVAVEYGYLELVKEMIKYYD
LAAAGIKARNGFYFLHIAAKQGDLDIVKVLMEAHSELSMTVDTANTTALHTAATQGHIEVVNYLLELEIALAAIARSNGKT
Predicted Coding Sequence 
GAGGGAATGGNAGACTTAAAAAAACAGCCXGACCACGACACCCCGGAAAAAGATGACGAAGTCGNNGCTGGGAAACGCGATGACACTGCA
TTGCATTCTGCTGCAAGAGCTGGAAATCTTAAAGCAGTATGGGAAATTATCCACCAGTCATCGGAGGAAGAGTTAATAGAATTGTTGTCA
AAGCAAAACTCAGCTGGGGAAACGGCATTATATGTTGCCGTGGAATATGGTTATCTAGAGTTAGTGAAGGAGATGATTAAGTACTATGAT
CTTGCGGCCGCCGGGATCAAAGCAAGGAATGGTTTTTATTTTCTACATATAGCCGCCAAACAAGGGGATTTGGATATCGTGAAGGTCCTA
ATGGAGGCTCATTCAGAGCTTTCCATGACAGTTGATACTGCAAACACTACAGCTCTGCATACTGCTGCAACTCAAGGACACATTGAAGTG
GTAAATTATCTATTGGAGCTGGAGATAGCCCTTGCTGCTATAGCTAGAAGTAATGGGAAGACX
Edits in Original Sequence 
(5')GAGGGAATGGNAGACTTAAAAAAACAGCCXGACCACGACACCCCGGAAAAAGATGACGAAGTCGNNGaCTGGGAAACGCGATGACA
CTGCATTGCATTCTGCTGCAAGAGCTGGAAATCTTAAAGCAGTATGGGAAATTATCCACCAGTCATCGGAGGAAGAGTTAATAGAATTGT
TGTCAAAGCAAAACTCAGCTGGGGAAACGGCATTATATGTTGCCGTGGAATATGGTTATCTAGAGTTAGTGAAGGAGATGATTAAGTACT
ATGATCTTGCGGCCGCCGGGATCAAAGCAAGGAATGGTTTTTATTTTCTACATATAGCCGCCAAACAAGGGGATTTGGATATCGTGAAGG
TCCTAATGGAGGCTCATTCAGAGCTTTCCATGACAGTTGATACTGCAAACACTACAGCTCTGCATACTGCTGCAACTCAAGGACACATTG
AAGTGGTAAATTATCTATTGGAGCTGGAGAgTAGCCCTTGCTGCTATAGCTAGAAGTAATGGGAAGACX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan