ESTScan Details for Unigene SGN-U307318

Score 
207
Direction 
Forward
Predicted Peptide Sequence 
VKEVLFPHWKKWAEINNKFCYDIRNFLRGEGLLSDLATRICGSGDVFLDGRGPAFSFNFIARNFGLSLVDLVSFSSSKLAKEFSWNCGEE
GATNKNDVLERRLKQIRNFLFILFISLGVPVLNMGDECGQSSGGSPAMEIEIPLTX
Predicted Coding Sequence 
AGXGTAAAGGAAGTCCTCTTCCCTCACTGGAAGAAATGGGCCGAAATAAATAACAAATTTTGTTATGACATAAGAAACTTCTTGAGGGGT
GAAGGTCTTCTGAGCGACCTCGCTACTCGTATATGTGGAAGTGGGGATGTCTTCTTGGATGGTCGAGGCCCTGCCTTCTCTTTCAATTTT
ATTGCTAGAAATTTTGGACTTTCGCTTGTGGATTTAGTCAGCTTCAGTAGCTCCAAGCTGGCAAAGGAGTTTAGTTGGAATTGTGGGGAA
GAAGGTGCTACAAATAAAAATGATGTGTTAGAAAGACGACTCAAACAAATTCGCAATTTTCTGTTCATTTTGTTTATTTCCTTGGGTGTT
CCAGTCCTTAATATGGGAGATGAATGTGGTCAGTCTTCTGGGGGTTCTCCTGCTATGGAGATAGAAATTCCTTTGACTGXX
Edits in Original Sequence 
(5')AGXGTAAAGGAAGTCCTCTTCCCTCACTGGAAGAAATGGGCCGAAATAAATAACAAATTTTGTTATGACATAAGAAACTTCTTGAG
GGGTGAAGGTCTTCTGAGCGACCTCGCTACTCGTATATGTGGAAGTGGGGATGTCTTCTTGGATGGTCGAGGCCCTGCCTTCTCTTTCAA
TTTTATTGCTAGAAATTTTGGACTTTCGCTTGTGGATTTAGTCAGCTTCAGTAGCTCCAAGCTGGCAAAGGAGTTTAGTTGGAATTGTGG
GGAAGAAGGTGCTACAAATAAAAATGATGTGTTAGAAAGACGACTCAAACAAATTCGCAATTTTCTGTTCATTTTGTTTATTTCCTTGGG
TGTTCCAGTCCTTAATATGGGAGATGAATGTGGTCAGTCTTCTGGGGGTTCTCCTGCgTATGGAGATAGAAATTCCTTTGACTGXX(3')
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan