ESTScan Details for Unigene SGN-U307377

Score 
146
Direction 
Reverse
Predicted Peptide Sequence 
NQYXAMKNVPEXIKDEXGDLKKAANYLVLHVIQSTKHDLDSFNKDEQSEDTQNPTRKVNHTNVHVCSTVPFPKCLHPCPKFTDAYAVKTL
GAPFKTTNATGGNPRKVKTRLQATCIEVLKVQPLSFIGTVIKHMGTSSRAPISAVAKLITDIRX
Predicted Coding Sequence 
XTGAATCAGTATGXAGCCATGAAAAATGTACCCGAAXACATAAAAGATGAAXCAGGAGATCTAAAGAAGGCAGCCAACTATTTAGTTCTG
CATGTCATACAATCTACAAAACATGACTTGGATTCTTTCAACAAGGATGAACAAAGTGAGGATACACAAAACCCAACACGGAAGGTGAAC
CATACAAATGTACACGTATGTAGCACTGTTCCATTCCCAAAGTGCCTCCATCCATGTCCAAAATTCACCGATGCTTATGCTGTCAAAACC
CTTGGTGCACCTTTTAAGACTACAAATGCAACTGGTGGAAACCCAAGAAAGGTCAAAACTAGATTACAAGCAACTTGCATAGAGGTTCTC
AAGGTCCAACCTTTAAGCTTCATTGGTACTGTCATCAAACACATGGGAACCAGCAGTAGGGCTCCAATTTCCGCTGTTGCAAAGTTGATC
ACTGACATTAGACXX
Edits in Original Sequence 
(5')XTGAATCAGTATGXAGCCATGAAAAATGTACCCGAAXACATAAAAGATGAAXCAGGAGATCTAAAcGAAGGCAGCCAACTATTTAG
TTCTGCATGTCATACAATCTACAAAACATGACTTGGATTCTTTCAACAAGGATGtAACAAAGTGAGGATACACAAAACCCAACACGGAAG
GTGAACCATACAAATGTACACGTATGTAGCACTGTTCCATTCCCAAAGTGCCTCCATCCATGTCCAAAATTCACCGATGCTTATGCTGTC
AAAACCCTTGaGTGCACCTTTTAAGACTACAAATGCAACTGGTGGAAACCCAAGAAAGGTCAAAACTAGATTACAAGCAACTTGCATAGA
GGTTCTCAAGGTCCAACCTTTAAGCTTCATTGGTACTGTCATCAAACACATGGGAACCAGCAGTAGGGCTCCAATTTCCGCTGTTGCAAA
GTTGATCACTGACATTAGACXX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan