ESTScan Details for Unigene SGN-U307465

Score 
643
Direction 
Forward
Predicted Peptide Sequence 
FIDKDQCIRLFEELNKYRTLPKISKEDFELIFDELDDSHDFKINLNEFADLCNAIALRFQKENSEPIFEKCPSIYHSPVSERLKNFVRSP
TFGYIVAFILVLNLVAVIIETTLDIEDNSAQQAWQKVEFVFGWIYVLEMLLKIYAYGFENYWRDGQNRFDFIVTLVIVVGETATFVAPNR
LTFLSNGEWIRYXSHFENAKIDKASDECSTIPSFCCHLLDPHTKSDAXTWEPYFVSCAFTAQLAYRYLAGIVNAGNPKLESTDLADNNYL
LFNFNDYPNGXGHTLQFTX
Predicted Coding Sequence 
XXATTCATTGACAAAGATCAGTGCATCCGACTGTTTGAAGAGCTGAACAAATACAGAACATTACCAAAGATATCCAAGGAAGATTTCGAA
CTAATATTTGATGAGTTGGATGATAGTCATGACTTCAAGATTAATTTGAACGAATTTGCTGATCTTTGCAATGCCATAGCACTGAGATTT
CAAAAGGAGAATTCAGAACCGATCTTTGAAAAATGTCCATCAATCTATCATTCGCCAGTTTCTGAGAGATTGAAGAACTTTGTTCGAAGC
CCTACATTTGGATATATCGTAGCATTCATTCTTGTCTTGAATCTTGTTGCTGTCATTATTGAGACAACGCTTGATATAGAGGACAATTCT
GCTCAACAGGCTTGGCAGAAGGTTGAATTCGTCTTTGGTTGGATTTATGTCCTGGAGATGCTGTTGAAAATTTATGCTTATGGTTTTGAA
AACTATTGGAGGGATGGTCAAAATCGCTTTGATTTTATTGTCACCTTGGTGATAGTTGTTGGAGAAACGGCCACTTTTGTGGCTCCCAAC
AGGCTGACTTTTCTTTCAAATGGGGAATGGATCCGCTATXCTTCTCATTTTGAGAATGCTAAGATTGATAAGGCTTCTGATGAATGTTCC
ACAATACCGAGCTTTTGTTGCCACCTTCTTGACCCTCATACCAAGTCTGATGCCATXACTTGGGAACCATATTTTGTGTCATGTGCATTT
ACTGCTCAATTGGCGTACAGGTATTTGGCGGGGATTGTGAATGCTGGCAACCCCAAGTTGGAGAGCACTGATCTTGCTGATAACAACTAT
TTACTCTTTAACTTCAACGATTACCCGAATGGAXATGGTCACACTCTTCAATTTACTGXX
Edits in Original Sequence 
(5')XXATTCATTGACAAAGATCAGTGCATCCGACTGTTTGAAGAGCTGAACAAATACAGAACATTACCAAAGATATCCAAGGAAGATTT
CGAACTAATATTTGATGAGTTGGATGATAGTCATGACTTCAAGATTAATTTGAACGAATTTGCTGATCTTTGCAATGCCATAGCACTGAG
ATTTCAAAAGGAGAATTCAGAACCGATCTTTGAAAAATGTCCATCAATCTATCATTCGCCAGTTTCTGAGAGATTGAAGAACTTTGTTCG
AAGCCCTACATTTGGATATATCGTAGCATTCATTCTTGTCTTGAATCTTGTTGCTGTCATTATTGAGACAACGCTTGATATAGAGGACAA
TTCTGCTCAACAGGCTTGGCAGAAGGTTGAATTCGTCTTTGGTTGGATTTATGTCCTGGAGATGCTGTTGAAAATTTATGCTTATGGTTT
TGAAAACTATTGGAGGGATGGTCAAAATCGCTTTGATTTTATTGTCACCTTGGTGATAGTTGTTGGAGAAACGGCCACTTTTGTGGCTCC
CAACAGGCTGACTTTTCTTTCAAATGGGGAATGGATCCGCTATXCTTCTCATTTTGAGAATGCTAAGATTGATAAGGCTTCTGATGAATG
TTCCACAATACCGAGCTTTTGTTGCCACCTTCTTGACCCTCATACCAAGTCTGATGCCATXACTTGGGAACCATATTTTGTGTCATGTGC
ATTTACTGCTCAATTGGCGTACAGGTATTTGGCGGGGATTGTGAATGCTGGCAACCCCAAGTTGGAGAGCACTGATCTTGCTGATAACAA
CTATTTACTCTTTAACTTCAACGATTACCCGAATGGAXATGGTCACACTCTTCAATTTACTGXX(3')GGTGATGGGGAACTGGCAAGTG
TGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan