ESTScan Details for Unigene SGN-U307568

Score 
205
Direction 
Reverse
Predicted Peptide Sequence 
SWTDEEDRKLAEAIEIYGPKRWKTIASKAGHATXLEALYKVLVAHIRLSDHLQALKGAVRVEAEMDELSETKHQGGNISDQEEDLIVRLH
NFWGTGENIRHGRRQKIDWIRIFVLTFSVDLIADGPXIAGRLPGRTDNEIKNYWNSHLSKKVHQKEKQSKGTAEMGCSRIRKKRKAMKEV
KADRTREGNSSSGGAPGDSKLSFDVDDFFDFSNEDPMTLEWISKFTEMDEADTLILFLITGRXLLPPKLVDDRTPIKEVVAATAVQDVGK
GVIX
Predicted Coding Sequence 
XXGTCATGGACTGATGAAGAAGATCGAAAACTGGCTGAAGCTATTGAGATCTATGGTCCAAAGCGATGGAAGACTATAGCATCCAAAGCA
GGTCATGCTACTAXTCTTGAAGCACTCTATAAAGTCTTAGTCGCGCACATTCGGTTATCTGATCATCTGCAGGCCTTAAAAGGTGCGGTA
AGAGTTGAGGCTGAGATGGATGAACTATCTGAGACCAAACATCAAGGAGGAAACATATCTGATCAAGAAGAAGACTTGATTGTTAGGCTT
CATAACTTCTGGGGAACAGGTGAAAATATTCGTCATGGACGTCGACAGAAAATTGATTGGATAAGGATTTTTGTTTTAACTTTTTCCGTC
GATTTAATTGCAGATGGTCCTXTGATAGCGGGAAGGTTGCCTGGTCGAACGGATAATGAGATCAAGAATTACTGGAATTCTCATTTGAGC
AAGAAAGTTCACCAAAAGGAGAAACAAAGCAAGGGAACTGCAGAAATGGGATGCTCTAGGATTCGGAAGAAAAGGAAGGCGATGAAAGAG
GTTAAAGCGGATAGGACGAGAGAAGGGAATTCATCTTCTGGTGGTGCTCCTGGAGATTCAAAACTGAGCTTCGATGTAGACGACTTCTTT
GATTTCTCCAACGAGGATCCTATGACTTTAGAGTGGATCAGCAAATTCACCGAAATGGATGAGGCTGACACCTTGATCCTCTTTCTTATT
ACTGGTAGAAXCCTATTGCCTCCAAAATTAGTGGATGACCGAACTCCTATCAAAGAGGTGGTTGCTGCTACCGCTGTCCAAGATGTCGGA
AAAGGCGTTATATXX
Edits in Original Sequence 
(5')XXGTCATGGACTGATGAAGAAGATCGAAAACTGGCTGAAGCTATTGAGATCTATGGTCCAAAGCGATGGAAGACTATAGCATCCAA
AGCAGGTCATGCTACTAXTCTTGAAGCACTCTATAAAGTCTTAGTCGCGCACATTCGGTTATCTGATCATCTGCAGGCCTTAAAAGGTGC
GGTAAGAGTTGtAGGCTGAGATGGATGAACTATCTGAGACCAAACATCAAGcGAGGAAACATATCTGATCAAGAAGAAGACTTGATTGTT
AGGCTTCATaAACTTCTGGGGAACAGGTGAAAATATTCGTCATGGACGTCGACtAGAAAATTGATTGGATAAGGATTTTTGTTTTAACTT
TTTCCGTCGATTTAATTGCAGATGGTCCTXTGATAGCGGGAAGGTTGCCTGGTCGAACGGATAATGAGATCAAGAATTACTGGAATTCTC
ATTTGAGCAAGAAAGTTCACCAAAAGGAGAAACAAAGCAAGGGAACTGCAGAAATGGGATGCTCTAGGATTCGGAAGAAAAGGAAGGCGA
TGAAAGAGGTTAAAGCGGATAGGACGAGAGAAGGGAATTCATCTTCTGGTGGTGCTCCTGGAGATTCAAAACTGAGCTTCGATGTAGACG
ACTTCTTTGATTTCTCCAACGAGGATCCTATGACTTTAGAGTGGATCAGCAAATTCACCGAAATGGATGAcGGCTGACACCTTGATCCTC
TTTCTTATTACTGGTAGAAXCCTATTGCCTCCAAAATTAGTGGATGACCGAACTCCTATCAAAGAGGTgGGTTGCTGCTACCGCTGTCCA
AGATGTCGGAAAAGGCGTTATATXX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan