ESTScan Details for Unigene SGN-U307665

Score 
520
Direction 
Forward
Predicted Peptide Sequence 
MAXNDPQSPAAPPRQLHQSPKRKIDSGPKKAPFSLPQMDHHDIHPVFVTDLCRLRCPGPPSHPPHDRSGXTATATADAGKPADLFPAAPH
YXSMQEQDLYDLLPHLNYSASEQTTMDCAICLESFKEGELSRKLPDCNHLFHLNCVDNWLTKKPNCPVCRTRVQLHSGASRSRDSDDDGK
FWWPVGA
Predicted Coding Sequence 
ATGGCCAXGAACGACCCTCAATCACCAGCGGCGCCACCTCGTCAATTGCATCAAAGTCCAAAACGAAAGATAGATTCXGGCCCCAAGAAA
GCTCCTTTTTCTCTTCCTCAAATGGATCATCATGACATTCATCCTGTCTTTGTTACTGATCTTTGTAGGCTTCGCTGCCCTGGTCCTCCT
TCACATCCTCCTCACGACCGCAGTGGTXCCACCGCCACCGCCACCGCCGACGCCGGCAAACCCGCCGATCTTTTTCCCGCAGCTCCTCAT
TATXATTCCATGCAAGAGCAAGACCTCTATGACCTCCTCCCGCACCTTAACTACTCTGCATCAGAACAGACCACAATGGATTGTGCAATT
TGCTTGGAGAGTTTCAAGGAGGGAGAGCTTAGCCGGAAGCTGCCGGATTGTAACCATTTATTTCACCTGAATTGTGTGGATAATTGGCTT
ACGAAAAAGCCCAACTGCCCTGTTTGTCGAACCCGGGTTCAGCTCCATTCTGGGGCTTCTAGGTCAAGAGACAGTGATGATGACGGGAAG
TTTTGGTGGCCTGTTGGGGCCTGA
Edits in Original Sequence 
GTTCCATTTAAAAAACCTCCGTTCCCCTTTCTCCTCCTCCATATTTATACACCAACAAATATATAAAGTGTCACGTACTTTATTTGTTCT
GAATTTCTAAAATCTTGAATTTAGGAATTCACAAATTCCAACACCACATGCCAATCATCCAAGAAATCTCAGGAAACTACCACCGGCACC
CCCGTGAA
(5')ATGGCCAXGAACGACCCTCAATCACCAGCGGCGCCACCTCGTCAATTGCATCAAAGTCCAAAACGAAAGATAGATTCX
GGCCCCAAGAAAGCTCCTTTTTCTCTTCCTCAAATGGATCATCATGACATTCATCCTGTCTTTGTTACTGATCTTTGTAGGCTTCGCTGC
CCTGGTCCTCCTTCACATCCTCCTCACGACCGCAGTGGTXCCACCGCCACCGCCACCGCCGACGCCGGCAAACCCGCCGATCTTTTTCCC
GCAGCTCCTCATTATXATTCCATGCAAGAGCAAGACCTCTATGACCTCCTCCCGCACCTTAACTACTCTGCATCAGAACAGACCACAATG
GATTGTGCAATTTGCTTGGAGAGTTTCAAGGAGGGAGAGCTTAGCCGGAAGCTGCCGGATTGTAACCATTTATTTCACCTGAATTGTGTG
GATAATTGGCTTACGAAAAAGCCCAACTGCCCTGTTTGTCGAACCCGGGTTCAGCTCCATTCTGGGGCTTCTAGGTCAAGAGACAGTGAT
GATGACGGGAAGTTTTGGTGGCCTGTTGGGGCCTGA(3')AAGATGGCAATGCTGGGATTTTGGATTTTAATGAAGGAAATAATTAAGGT
ACGTGAAGAAGAAATATATTAGAGAGGCTTTTTGCTGAGCTGCTTAAGTGGGTAATTTTAGTTAGCAACTTAGCATAGTGTTTTTTTTTC
T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan