ESTScan Details for Unigene SGN-U307671

Score 
573
Direction 
Forward
Predicted Peptide Sequence 
MTTAAVTSRVERLANSGIQLIPKEYVRQELTNMGNVFEEEKNNEGPQVPTIDLGDIEAEDYSVRERCHNELKKAAMEWGVMHLVNHGISN
ELINRVKVAGEAFFNSPFEEKEKYANDQASGKLQGYGSKLANTASGQLEWEDYFFHCVFPEDKRDLSIWPKTPEDYIPAASEYAKQLRGL
ATKLLAVLSLGLG
Predicted Coding Sequence 
ATGACCACTGCTGCGGTGACTTCAAGAGTTGAGAGGTTGGCCAACAGTGGGATTCAATTAATACCAAAAGAGTATGTGAGGCAAGAGCTG
ACGAACATGGGTAACGTCTTTGAGGAAGAGAAAAACAACGAAGGGCCTCAGGTGCCAACCATTGATTTGGGGGACATTGAAGCAGAGGAC
TATTCTGTTCGTGAGAGATGTCACAACGAGTTGAAGAAGGCTGCCATGGAGTGGGGAGTGATGCACCTTGTCAACCATGGCATATCAAAT
GAGCTCATTAATCGAGTCAAGGTTGCTGGAGAGGCCTTCTTCAATTCACCCTTTGAGGAAAAGGAGAAGTATGCCAATGATCAGGCATCA
GGCAAACTGCAAGGATACGGCAGCAAACTAGCAAACACTGCCAGTGGTCAGCTTGAATGGGAGGACTACTTTTTCCATTGTGTTTTCCCC
GAGGACAAGCGGGATTTGTCGATTTGGCCCAAGACTCCAGAAGACTATATCCCTGCAGCGAGTGAGTATGCAAAGCAATTGAGGGGCTTG
GCAACCAAGCTATTAGCTGTGCTGTCTCTTGGCTTGGGA
Edits in Original Sequence 
CCCCGAAGATGCAGAATTCGGCTCTCCGCAGGCTTTAAATATACCCTGTTAAATAGAAAAAGCGATATCAAAAGTAGGTAATCGGGTAGA
GT
(5')ATGACCACTGCTGCGGTGACTTCAAGAGTTGAGAGGTTGGCCAACAGTGGGATTCAATTAATACCAAAAGAGTATGTGAGGCAA
GAGCTGACGAACATGGGTAACGTCTTTGAGGAAGAGAAAAACAACGAAGGGCCTCAGGTGCCAACCATTGATTTGGGGGACATTGAAGCA
GAGGACTATTCTGTTCGTGAGAGATGTCACAACGAGTTGAAGAAGGCTGCCATGGAGTGGGGAGTGATGCACCTTGTCAACCATGGCATA
TCAAATGAGCTCATTAATCGAGTCAAGGTTGCTGGAGAGGCCTTCTTCAATTCACCCTTTGAGGAAAAGGAGAAGTATGCCAATGATCAG
GCATCAGGCAAACTGCAAGGATACGGCAGCAAACTAGCAAACACTGCCAGTGGTCAGCTTGAATGGGAGGACTACTTTTTCCATTGTGTT
TTCCCCGAGGACAAGCGGGATTTGTCGATTTGGCCCAAGACTCCAGAAGACTATATCCCTGCAGCGAGTGAGTATGCAAAGCAATTGAGG
GGCTTGGCAACCAAGCTATTAGCTGTGCTGTCTCTTGGCTTGGGA(3')CTCTTGGCTTGGGATTAGAAGAAGGCAGGCTAGAAAAGGGA
GTTGGTGTTATCGAAGAGTTATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan