ESTScan Details for Unigene SGN-U307746

Score 
353
Direction 
Forward
Predicted Peptide Sequence 
LIRNGLSILFKEGPSAYKAYYLRQMKIWNTSPTKQRELSKMLDEWAVYIRRKYGHKMLSSSVYLSEAEPFLEQYAKRSPQNQALIGSAGN
LVRSEDFLAIIEGGRDEEGDLEQERDAGPVTTVKDRVAKDEGLIVFFPGIPGCAKSALX
Predicted Coding Sequence 
XTTTTGATCAGGAATGGCTTGTCTATTCTCTTTAAAGAAGGTCCATCTGCCTACAAAGCCTACTATTTGAGACAAATGAAGATATGGAAT
ACTTCACCTACAAAGCAAAGGGAATTGAGCAAAATGCTCGATGAATGGGCAGTATACATACGCAGAAAGTATGGACACAAAATGCTGTCT
TCTTCTGTATACCTTAGTGAGGCTGAGCCTTTTCTGGAGCAATATGCAAAGCGCAGTCCACAAAATCAAGCTTTGATAGGATCTGCTGGA
AACTTAGTAAGATCAGAAGACTTCTTGGCCATTATTGAGGGAGGAAGAGATGAAGAGGGTGACCTTGAGCAAGAGAGGGATGCTGGACCA
GTAACTACGGTTAAGGACAGAGTTGCCAAGGATGAGGGCCTCATTGTCTTCTTTCCAGGAATACCTGGTTGTGCAAAATCTGCACTTTXX
Edits in Original Sequence 
(5')XTTTTGATCAGGAATGGCTTGTCTATTCTCTTTAAAGAAGGTCCATCTGCCTACAAAGCCTACTATTTGAGACAAATGAAGATATG
GAATACTTCACCTACAAAGCAAAGGGAATTGAGCAAAATGCTCGATGAATGGGCAGTATACATACGCAGAAAGTATGGACACAAAATGCT
GTCTTCTTCTGTATACCTTAGTGAGGCTGAGCCTTTTCTGGAGCAATATGCAAAGCGCAGTCCACAAAATCAAGCTTTGATAGGATCTGC
TGGAAACTTAGTAAGATCAGAAGACTTCTTGGCCATTATTGAGGGAGGAAGAGATGAAGAGGGTGACCTTGAGCAAGAGAGGGATGCTGG
ACCAGTAACTACGGTTAAGGACAGAGTTGCCAAGGATGAGGGCCTCATTGTCTTCTTTCCAGGAATACCTGGTTGTGCAAAATCTGCACT
TTXX(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan