ESTScan Details for Unigene SGN-U307811

Score 
52
Direction 
Forward
Predicted Peptide Sequence 
PMGTYPYQPSYPDSGDSSPPVPEIDFENPAPWEDSQNPQQSLASKVKFMCSYGGKIHPRPHDNLLSYVGGETKILAVDRSITVCIADREA
IVAXVIAPAVSFKYQLPGEDLDALISVTNDDDLEHMMHEYDRLYRAVSQAREAEVVSVSGESCPPSQSPTVVGARSFGSDDQVIKSEKER
FVEALNSGPIQTAPPPSAV
Predicted Coding Sequence 
CCCATGGGGACCTACCCTTACCAGCCGTCTTATCCTGATTCCGGCGATTCCTCTCCXCCGGTCCCCGAAATTGACTTCGAAAACCCAGCC
CCCTGGGAGGACTCCCAGAACCCCCAACAATCCCTCGCCTCTAAGGTCAAATTCATGTGTAGCTATGGCGGCAAAATCCACCCCCGCCCC
CATGACAATCTGCTGTCTTATGTAGGCGGCGAGACTAAAATCCTAGCCGTCGATCGTAGTATTACXGTTTGCATCGCTGATCGCGAAGCT
ATCGTCGCTGXTGTGATTGCGCCAGCXGTTTCGTTCAAGTATCAGCTTCCCGGGGAAGATCTTGATGCGTTGATCTCCGTGACAAATGAT
GACGACCTTGAACACATGATGCATGAGTATGATCGGCTCTACAGGGCXGTCTCCCAAGCCCGCGAGGCTGAGGTTGTTTCTGTTTCCGGC
GAGTCCTGCCCTCCGTCGCAGTCGCCGACGGTCGTTGGGGCGAGGAGTTTTGGGTCTGATGATCAGGTGATTAAGTCTGAGAAAGAGAGG
TTTGTGGAGGCTCTGAACTCTGGGCCTATTCAGACCGCTCCTCCGCCGTCCGCCGTG
Edits in Original Sequence 
(5')CCCATGGGGACCTACCCTTACCAGCCGTCTTATCCTGATTCCGGCGATTCCTCTCCXCCGGTCCCgCGAAATTGACTTCGAAAACC
CAGCCCCCTGGGAGGACTCCCAGAACCCCCAACAATCCCTCGCCTCTAAGGTCAAATTCATGTGTAGCTATGGCGGCAAAATCCACCCCC
GCCCCCATGACAATCTGCTGTCTTATGTAGGCGGCGAGACTAAAATCCTAGCCGTCGATCGTAGTATTACXGTTTGCATCGCTGATCGCG
AAGCTATCGTCGCTGXTGTGATTGCGCCAGCXGTTTCGTTCAAGTATCAGCTTCCCGGGGAAGATCTTGATGCGTTGATCTCCGTGACAA
ATGATGACGACCTTGAACACATGATGCATGAGTATGATCGGCTCTACAGGGCXGTCTCCCAAGCCCGCGAGGCTGAGGTTGTTTCTGTTT
CCGGCGAGTCCTGCgCCTCCGTCGCAGTCGCCGACGGTCGTTGGGGCGAGGAGTTTTGGGTCTGATGATCAGGTGATTAAGTCTGAGAAA
GAGAGGTTTGTGGAGGCTCTGAACTCTGGGCCTATTCAGACCGCTCCTCCGCCGTCCGCCGTG(3')TGCGTCTCCGCCTCAGACCGCGA
ATGTGGATTTCTTATTCGGGTAGGAGAAAGGAATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan