ESTScan Details for Unigene SGN-U307912

Score 
204
Direction 
Forward
Predicted Peptide Sequence 
VKRRDAEQWMSHRLLPDSLKERIGDVNNINGRKIGGVDEENLIQNLPKDLRGDIKRRLCLALLVRVPMFEKLDEQLLDALGDRLKPVLYT
GHSFIVREGDPVDEMLFIVRGKLLTVSTNGRRTGFFNSDYLKAGDFCGEELLTWALDPHSSSNLPISTRTVQALSEVEAFALIADDLKFV
ASQFTDYAVGNFATLLGFTL
Predicted Coding Sequence 
GTAAAACGACGAGATGCGGAACAGTGGATGTCTCATCGTTTGCTCCCTGACAGTTTAAAGGAGCGGATCGGCGATGTGAACAATATAAAT
GGCAGGAAAATAGGXGGTGTTGATGAGGAAAATTTGATTCAAAACCTCCCCAAAGACCTCAGAGGAGATATCAAACGCCGCCTTTGTTTG
GCTCTGCTAGTGAGGGTTCCAATGTTCGAAAAATTGGATGAACAACTCTTGGATGCATTGGGTGATCGTCTTAAGCCAGTATTATACACC
GGACACAGCTTCATTGTGAGGGAGGGTGACCCAGTTGATGAGATGTTGTTCATAGTGCGGGGCAAACTGCTAACTGTGAGCACCAATGGG
AGAAGGACTGGCTTTTTCAACTCTGATTATCTAAAAGCTGGTGACTTTTGTGGAGAGGAGCTGCTTACTTGGGCACTGGACCCCCATTCG
TCATCTAATCTCCCAATATCAACTAGAACTGTTCAAGCTCTCTCAGAGGTCGAAGCATTTGCTCTAATAGCGGATGATTTGAAATTTGTG
GCCTCACAGTTTACCGACTACGCAGTAGGCAACTTCGCCACACTTTTAGGTTTTACTCTX
Edits in Original Sequence 
(5')GTAAAACGACGAGATGCGGAACAGTGGATGTCTCATCGTTTGCTCCCTGACAGTTTAAAGGAGCGGATCGtGCGATGTGAACAATA
TAAATGGCAGGAAAATAGGXGGTGTTGATGAGGAAAATTTGATTCAAAACCTCCCCAAAGACCTCAGAGGAGATATCAAACGCCGCCTTT
GTTTGGCTCTGCTAGTGAGGGTTCCAATGTTCGAAAAATTGGATGAACAACTCTTGGATGCATTGGGTGATCGTCTTAAGCCAGTATTAT
ACACCGGACACAGCTTCATTGTGAGGGAGGGTGACCCAGTTGATGAGATGTTGTTCATAGTGCGGGGCAAACTGCTAACTGTGAGCACCA
ATGGGAGAAGGACTGGCTTTTTCAACTCTGATTATCTAAAAGCTGGTGACTTTTGTGGAGAGGAGCTGCTTACTTGGGCACTGGACCCCC
ATTCGTCATCTAATCTCCCAATATCAACTAGAACTGTTCAAGCTCTCTCAGAGGTCGAAGCATTTGCTCTAATAGCGGATGATTTGAAAT
TTGTGGCCTCACAGTTTACgCGACTACGCAGTAGGCAACTTCGCCACACTTTTAGGTTTTACTCTX(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan