ESTScan Details for Unigene SGN-U307978

Score 
293
Direction 
Reverse
Predicted Peptide Sequence 
KVGDFDRAKSLMDELLHSYEDVNIYNNKQQQNSDQGENKESLVRRLDVQPNLITYTTLISTYCKQHGVEEVLAIYEELIVAGLFPDVVTY
STVICALCKAGRIAEAKLLFEEMKMVGVDPNHVTYSILVDTLFKAGNGIAADSIQSQMVVRGIAFDXGGVYNFDGWAFQAX
Predicted Coding Sequence 
XGTAAAGTAGGAGATTTTGACAGGGCCAAGAGTCTCATGGATGAGCTCTTGCATTCTTATGAGGATGTAAACATTTATAACAATAAGCAA
CAACAGAACAGTGATCAGGGTGAAAATAAGGAATCTTTGGTTAGACGGTTGGATGTTCAACCAAATCTAATAACGTATACAACATTGATT
AGTACGTACTGCAAGCAGCATGGAGTTGAAGAAGTACTTGCCATATACGAGGAATTGATTGTGGCAGGGTTGTTTCCTGATGTAGTTACA
TATAGTACAGTTATATGTGCTCTTTGTAAGGCTGGGAGAATTGCTGAAGCCAAATTACTTTTTGAGGAGATGAAAATGGTGGGAGTGGAT
CCCAATCATGTCACTTATTCAATCCTTGTGGATACTTTATTTAAAGCTGGGAATGGCATAGCTGCAGATAGTATACAGAGTCAAATGGTA
GTTCGTGGTATTGCCTTTGATGXTGGTGGTGTTTACAACTTTGATGGATGGGCTTTTCAAGCTAGX
Edits in Original Sequence 
(5')XGTAAAGTAGGAGATTTTGACAGGGCCAAGAGTCTCATGGATGAGCTCTTGCATTCTTATGAGGATGTAAACATTTATAACAATAA
GCAACAACAGAACAGTGATCAGGGTGAAAATAAGGAATCTTTGGTTAGACGGTTGGATGTTCAACCAAATCTAATAACGTATACAACATT
GATTAGTACGTACTGCAAGCAGCATGGAGTTGAAGAAGTACTTGCCATATACGAGGAATTGATTGTGGCAGGGTTGTTTCCTGATGTAGT
TACATATAGTACAGTTATATGTGCTCTTTGTAAGGCTGGGAGAATTGCTGAAGCCAAATTACTTTTTGAGGAGATGAAAATGGTGGGAGT
GGATCCCAATCATGTCACTTATTCAATCCTTGTGGATACTTTATTTAAAGCTGGGAATGGCATAGCTGCAGATAGTATACAGAGTCAAAT
GGTAGTTCGTGGTATTGCCTTTGATGXTGGTGGTGTTTACAACTTTGATGGATGGGCTTTTCAAGCTAGX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan