ESTScan Details for Unigene SGN-U307987

Score 
678
Direction 
Forward
Predicted Peptide Sequence 
PTACKQKLIIHTPTFSSLSSQTLXTQNKGSEMGVDYYKILQVDKSAKDEDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD
PEKRAIYDQYGEEGLKGQVPPPGAGGPGRATFFQTGDGPNVFRFNPRNANDIFDEFFGFSTPFGGMGGAGGMNGGGTRFPSSMFGDDIFS
SFGEGRTMNSVPRKAPPIEQNFALQSEELSKGTTKKMKISREIADAGGKNFPVQGDSDH
Predicted Coding Sequence 
XXACCTACTGCCTGTAAGCAAAAGTTAATCATTCATACGCCAACCTTTTCTTCTCTTTCTTCACAAACACTTGXTACACAGAACAAGGGA
AGTGAAATGGGTGTGGACTATTACAAAATCTTGCAGGTGGATAAAAGTGCGAAGGATGAAGATTTAAAGAAAGCTTATAGAAAGCTGGCG
ATGAAATGGCATCCTGACAAGAACCCCAACAACAAGAAGGAAGCTGAGGCCAAATTCAAACAGATTTCAGAAGCCTATGAGGTATTAAGC
GATCCTGAAAAGAGGGCCATCTATGATCAGTATGGGGAAGAAGGCCTAAAAGGGCAAGTGCCGCCACCTGGTGCTGGTGGGCCTGGCCGG
GCGACGTTCTTCCAGACTGGAGATGGACCAAATGTGTTCAGATTCAATCCCAGAAATGCGAATGATATTTTTGATGAATTTTTCGGTTTT
TCGACTCCATTTGGTGGGATGGGAGGTGCTGGTGGCATGAATGGTGGTGGTACAAGGTTTCCTAGTTCAATGTTTGGAGATGATATATTT
AGTTCATTTGGAGAGGGTAGAACCATGAATTCGGTTCCTAGGAAAGCACCGCCAATCGAGCAAAATTTTGCCTTGCAGTCTGAAGAGCTT
TCCAAGGGAACTACCAAGAAGATGAAGATCTCAAGAGAAATAGCTGATGCAGGTGGGAAGAACTTTCCAGTACAGGGAGATTCTGACCAT
Edits in Original Sequence 
(5')XXACCTACTGCCTGTAAGCAAAAGTTAATCATTCATACGCCAACCTTTTCTTCTCTTTCTTCACAAACACTTGXTACACAGAACAA
GGGAAGTGAAATGGGTGTGGACTATTACAAAATCTTGCAGGTGGATAAAAGTGCGAAGGATGAAGATTTAAAGAAAGCTTATAGAAAGCT
GGCGATGAAATGGCATCCTGACAAGAACCCCAACAACAAGAAGGAAGCTGAGGCCAAATTCAAACAGATTTCAGAAGCCTATGAGGTATT
AAGCGATCCTGAAAAGAGGGCCATCTATGATCAGTATGGGGAAGAAGGCCTAAAAGGGCAAGTGCCGCCACCTGGTGCTGGTGGGCCTGG
CCGGGCGACGTTCTTCCAGACTGGAGATGGACCAAATGTGTTCAGATTCAATCCCAGAAATGCGAATGATATTTTTGATGAATTTTTCGG
TTTTTCGACTCCATTTGGTGGGATGGGAGGTGCTGGTGGCATGAATGGTGGTGGTACAAGGTTTCCTAGTTCAATGTTTGGAGATGATAT
ATTTAGTTCATTTGGAGAGGGTAGAACCATGAATTCGGTTCCTAGGAAAGCACCGCCAATCGAGCAAAATTTTGCCTTGCAGTCTcGAAG
AGCTTTCCAAGGGAACTACCAAGAAGATGAAGATCTCAAGAGAAATAGCTGATGCAGGTGGGAAGAACTTTaCCAGTACAGGGAGATTCT
GACCAT(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan