ESTScan Details for Unigene SGN-U308018

Score 
505
Direction 
Forward
Predicted Peptide Sequence 
MADNYSSSSYSQPTLPLHLCFFLLILFTFVSFTWYINYENIFEPLFDQVKXDPRGFSFTTSSSDAPTFFFDRSWIYLPIPDQDSLHRAGG
TPWGVGLLLVILLFMVSYQSGLRERWFPLQADDEDGFSWIVVIRILSGNICNMEKTGEKSCGV
Predicted Coding Sequence 
ATGGCTGATAACTATTCTTCTTCATCTTATTCTCAGCCCACTTTGCCACTACACCTTTGTTTCTTCCTTCTGATATTGTTCACCTTTGTT
AGTTTCACATGGTACATCAACTATGAGAATATCTTCGAACCCTTGTTTGATCAGGTTAAGXTTGATCCTCGTGGTTTCTCCTTTACTACT
TCTTCTAGCGATGCACCTACTTTCTTCTTTGACAGGTCTTGGATTTATTTACCAATTCCTGATCAAGACTCACTTCACAGGGCTGGTGGA
ACTCCATGGGGTGTTGGTCTGCTTCTTGTGATTCTTCTCTTCATGGTTTCTTACCAATCTGGCTTGAGAGAGCGGTGGTTCCCTCTTCAA
GCAGATGATGAAGATGGCTTCTCCTGGATTGTGGTGATCAGGATTTTAAGTGGGAATATCTGCAACATGGAGAAAACTGGTGAAAAATCT
TGTGGTGTTTAG
Edits in Original Sequence 
GCACACACACTTCACCTAGCTCAGTCAGCAAATAATCTCCAAACCCGTTTATCCTTAAGCTTTGCTAAGACTAAATTGGCTGGAAA(5')
ATGGCTGATAACTATTCTTCTTCATCTTATTCTCAGCCCACTTTGCCACTACACCTTTGTTTCTTCCTTCTGATATTGTTCACCTTTGTT
AGTTTCACATGGTACATCAACTATGAGAATATCTTCGAACCCTTGTTTGATCAGGTTAAGXTTGATCCTCGTGGTTTCTCCTTTACTACT
TCTTCTAGCGATGCACCTACTTTCTTCgTTTGACAGGTCTTGGATTTATTTACCAATTCCTGATCAAGACTCACTTCACAGGGCTGGTGG
AACTCCATGGGGTGTTGGTCTGCTTCTTGTGATTCTTCTCTTCATGGTTTCTTACCAATCTGGCTTGAGAGAGCGGTGGTTCCCTCTTCt
AAGCAGATGATGAAGATGGCTTCTCCTGGATTGTGGTGATCAGGATTTTAAGTGGGAATATCTGCAACATGGAGAAAACTGGTGAAAAAT
CTTGTGGTGTTTAG(3')GTCACAACTATGTATATTTTGAGTTTTAGGCAAGGGTGATAATTGAGAATTGAGTTTGTCAATCTCTTTCTC
TCTTTGGCTGAGTTTCCATGTACTTCTTTTGACCTCTAGTATATAGCAGTAATAGGGGAATGGTTAATGAATGGCCACNTTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan