ESTScan Details for Unigene SGN-U308140

Score 
322
Direction 
Forward
Predicted Peptide Sequence 
MAAKLLLLSPPRLSRPRNANSNQLIKTTSAAQTWLLQAEDYTHQQQVPYKNITAPIPDDFVIVLMGDDDRGFFTHLPLPAELFFQYGHRF
TETLSSSVVPVALAAHHLGXPASAFSSPDDDTLVPPDSIVAAAAIHKPATTLPGTVCHLRSRPLVPYQALCQIQDRSEDIYCSVRWGGES
DAQSGGRSILPLLCSQXFRGVGERRDYYVLRDDGSQSKPGSTTHFLHLHKSGQWCPRSYHNC
Predicted Coding Sequence 
ATGGCAGCGAAGCTTCTGCTGCTCTCTCCTCCTCGTCTCTCTCGCCCTCGCAATGCTAATAGTAATCAGTTAATCAAAACCACCAGCGCA
GCCCAGACATGGTTGTTGCAGGCCGAAGATTACACTCATCAGCAGCAAGTGCCATACAAGAATATTACCGCCCCAATACCAGACGATTTT
GTCATCGTTCTCATGGGAGACGACGACCGTGGCTTCTTCACCCACCTCCCCCTGCCTGCAGAGCTCTTCTTCCAGTACGGTCATCGCTTC
ACXGAAACTCTATCGTCTTCGGTAGTACCTGTAGCTTTAGCAGCTCATCATCTTGGAXCTCCAGCATCCGCGTTCTCCTCCCCTGATGAC
GATACTCTTGTTCCTCCCGACAGCATCGTGGCGGCGGCGGCTATTCACAAGCCAGCTACTACACTTCCTGGGACTGTTTGTCATCTCCGT
TCCCGGCCTTTGGTCCCTTATCAAGCGCTCTGTCAAATCCAAGATCGTTCAGAAGACATTTACTGCAGTGTCAGATGGGGAGGGGAATCT
GATGCCCAATCAGGTGGCCGGAGCATTCTGCCCCTTCTTTGCTCGCAANCATTTCGTGGTGTTGGAGAGAGGAGAGACTATTACGTTTTG
AGGGATGATGGTTCCCAGTCGAAGCCAGGCAGCACTACTCACTTTCTGCACCTGCATAAGTCTGGGCAGTGGTGCCCTCGTTCTTACCAT
AACTGT
Edits in Original Sequence 
GCAGAAGCCAA(5')ATGGCAGCGAAGCTTCTGCTGCTCTCTCCTCCTCGTCTCTCTCGCCCTCGCAATGCTAATAGTAATCAGTTAATC
AAAACCACCAGCGCAGCCgCAGACATGGTTGTTGCAGGCCGAAGATTACACTCATCAGCAGCAAGTGCCATACAAGAATATTACCGCCCC
AATACCAGACGATTTTGTCATCGTTCTCATGGGAGACGACGACCGTGGCTTCTTCACCCACCTCCCCCTGCCTGCAGAGCTCTTCTTCCA
GTACGGTCATCGCTTCACXGAAACTCTATCGTCTTCGGTAGTACCTGTAGCTTTAGCAGCTCATCATCTTGGAXCTCCAGCATCCGCGTT
CTCCTCCCCTGATGACGATACTCTTGTTCCTCgCCGACAGCATCGTGaGCGGCGGCGGCTATTCACAAGCCAGCTACTACACTTcCCTGG
GACTGTTTGTCATCTCCGTTCCCGGCCTTTGGTCCCTTATCAAGCGCTCTGTCAAATCCAAGATCGTTCAGAAGACATTTACTGCAGTGT
CAGATGGGGAGGGGAATCTGATGCCCAATCAGGTGGCCGGAGCATTCTGCCCCTTCTTTGCTCGCAANCATTTCGTGGTGTTGGAGAGAG
GAGAGACTATTACGTTTTGAGGGATGATGGTTCCCAGTCGAAGCCAGGCAGCACTACTCACTTTCTGCACCTGCATAAGTCTGGGCAGTG
GTGCCCTCGTTCTTACCATAACTGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan