ESTScan Details for Unigene SGN-U308225

Score 
86
Direction 
Forward
Predicted Peptide Sequence 
ILCDFGVFSQPIASNSASTFLSEGIFGHHIAQGRNLLQATTACPVNFEFQNYTIITSQCKGPQYPPNLCCKAXKGFWALVPFAEQVNDLS
NDCATTMFSYINLNX
Predicted Coding Sequence 
XCAATTTTGTGCGATTTTGGTGTTTTTTCTCAGCCTATTGCTAGCAACTCAGCTTCCACTTTCCTTTCAGAAGGCATATTTGGGCATCAT
ATTGCACAAGGGAGAAACCTCCTCCAGGCAACGACAGCTTGCCCTGTTAACTTCGAGTTTCAGAATTACACAATCATCACTAGTCAATGC
AAAGGTCCTCAATATCCACCCAACCTTTGCTGTAAGGCTTTXAAAGGATTTTGGGCCCTGGTCCCTTTTGCAGAGCAGGTGAATGATTTA
TCAAATGACTGTGCCACAACCATGTTCAGCTACATTAACCTTAATGXX
Edits in Original Sequence 
(5')XCAATTTTGTGCGATTTTGGTGTTTTTTCTCAGCCTATTaGCTAGCAACTCAGCTTCCACTTTCCTTTCAGAAGGCATATTTGGGC
ATCATATTGCACAAGGGAGAAACCTCCTCCAGGCAACGACAGCTTGCCCTGTTAACTTCGAGTTTCAGAATTACACAATCATCACTAGTC
AATGCAAAGGTCCTCAATATCCACCCAACCTTTGCTGTAAGGCTTTXAAAGGATTTTGGGCCCTGGTCCCTTTTGCAGAGCAGGTGAATG
ATTTATCAAATGACTGTGCCACAACCATGTTCAGCTACATTAACCTTAATGXX(3')G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan