Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U308237

Score 
212
Direction 
Reverse
Predicted Peptide Sequence 
FDMKDMGLAVVIIGVKIARISDGFGLEPNSFVDKILEKFNKNDSGIARTPLDNSFHLSKNRGESISQVEYSRIIGSVMYLMSCTRPDIAY
AVSKLSRFTSNPSADHWKAILRVLKYFGTLGTMDCITLDXPAVLEGYADANWISDIKDSKSASGYVFTLASGAVSWKSSKQTX
Predicted Coding Sequence 
XXATTTGACATGAAAGATATGGGGCTTGCTGTTGTAATTATTGGAGTTAAAATTGCAAGAATATCAGACGGGTTTGGTCTTGAGCCAAAC
TCATTTGTGGACAAGATTCTGGAAAAATTCAATAAGAATGATTCTGGAATTGCAAGAACTCCATTAGACAATAGTTTCCATCTATCTAAG
AATAGAGGAGAGAGTATTTCTCAAGTAGAATACTCAAGAATCATTGGAAGTGTAATGTATTTAATGAGTTGTACTAGACCTGACATTGCA
TATGCTGTGAGCAAATTGAGCAGGTTTACAAGCAACCCGAGTGCTGATCATTGGAAAGCAATTTTAAGGGTGCTTAAATACTTCGGTACA
CTCGGAACTATGGACTGCATTACACTAGATXACCCTGCTGTTTTAGAAGGGTATGCTGATGCAAATTGGATATCTGATATAAAAGATTCA
AAATCCGCAAGTGGATATGTGTTCACACTTGCCAGTGGGGCAGTATCTTGGAAGTCTTCTAAACAAACTAXX
Edits in Original Sequence 
(5')XXATTTGACATGAAAGATATGGGGCTTGCTGTTGTAATTATTGGAGTTAAAATTGCAAGAATATCAGACGGGTTTGGTCTTGAGCC
AAACTCATTaTGTGGACAAGATTCTGGAAAAATTCAATAAGAATGATTCTGGAATTGCAAGAACTCCATTAGACAATAGTTTCCATCTAT
CTAAGAATAGAGGAGAGAGTATTTCTCAAGTAGAATACTCAAGAATCATTGGAAGTGTAATGTATTTAATGAGTTGTACTAGACCTGACA
TTGCATATGCTGTGAGCAAATTGAGCAGGTTTACAAGCAACCCGAGTGCTGATCATTGGAAAGCAATTTTAAGGGTGCTTAAATACTTaC
GGTACACTCGGAACTATGGACTGCATTACACTAGATXACCCTGCTGTTTTAGAAGGGTATGCTGATGCAAATTGGATATCTGATATAAAA
GATTCAAAATCCGCAAGTGGATATGTGTTCACACTTGCCAGTGGGGCAGTATCTTGGAAGTCTTCTAAACAAACTAXX(3')GATTCAAA
ATCCGCAAGTGGATATGTGTTCACACTTGCCAGTGGGGCAGTATCTTGGAAGTCTTCTAAACAAACTATTGAGCGTAGATCTACAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan