ESTScan Details for Unigene SGN-U308266

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
VNLLERQLRETDVQLQHAVASAEASQEKQSMLYSTIKDMEDLIEDLKSKVSKAESRTESAEEKCIILSETNSDLHDEIKFLRNRMECLEA
SLHLAEETKRATAKDIGIRTKLITDLIMKLALERERLHXADIFANEGEKVSFKASTAHEQRSFYKCX
Predicted Coding Sequence 
XXGGTAAATCTACTTGAAAGGCAATTGAGAGAGACTGATGTTCAGCTACAACATGCAGTTGCATCTGCTGAAGCAAGTCAGGAGAAGCAA
AGCATGTTATATTCGACGATCAAGGATATGGAAGATTTGATAGAAGATCTCAAATCTAAAGTCTCAAAAGCTGAAAGTCGGACTGAGAGT
GCTGAAGAAAAGTGTATAATATTGTCAGAAACCAACTCAGATCTACATGACGAGATAAAGTTTCTAAGGAACAGAATGGAGTGCTTGGAA
GCATCACTACATCTAGCTGAGGAGACAAAGAGAGCAACTGCAAAGGATATTGGTATCCGTACTAAGTTGATAACAGATCTTATCATGAAG
TTGGCTCTGGAAAGAGAACGGCTGCATAXAGCAGATATCTTTGCTAACGAAGGAGAAAAAGTTTCTTTTAAAGCGTCTACAGCACATGAG
CAAAGGTCATTCTATAAATGCAAX
Edits in Original Sequence 
(5')XXGGTAAATCTACTTGAAAGGCAATTGAGAGAGACTGATGTTCAGCTACAACATGCAGTTGCATCTGCTGAAGCAAGTCAGGAGAA
GCAAAGCATGTTATATTCGACGATCAAGGATATGGAAGATTTGATAGAAGATCTCAAATCTAAAGTCTCAAAAGCTGAAAGTCGGACTGA
GAGTGCTGAAGAAAAGTGTATAATATTGTCAGAAACCAACTCAGATCTACATGACGAGATAAAGTTTCTAAGGAACAGAATGGAGTGCTT
GGAAGCATCACTACATCTAGCTGAGGAGACAAAGAGAGCAACTGCAAAGGATATTGGTATCCGTACTAAGTTGATAACAGATCTTATCAT
GAAGTTGGCTCTGGAAAGAGAACGGCTGCATAXAGCAGATATCTTTGCTAACGAAGGAGAAAAAGTTTCTTTTAAAGCGTCTACAGCACA
TGAGCAAAGGTCATTCTATAAATGCAAX(3')A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan